Align ABC transporter for Glycerol, permease component 1 (characterized)
to candidate WP_106712565.1 CU102_RS18495 sugar ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_793 (298 letters) >NCBI__GCF_003010955.1:WP_106712565.1 Length = 292 Score = 77.8 bits (190), Expect = 3e-19 Identities = 60/224 (26%), Positives = 103/224 (45%), Gaps = 20/224 (8%) Query: 70 WRQLT--------FSLAVLAVEIPLGILLALSMPAQGWKSSAVLVVVALSLLIPWNVVGT 121 WR +T + + + + L ILL + +G+ L +ALS + V G Sbjct: 66 WRAITNLGIFASLYIIICTVIGLGLAILLDQKIRIEGFLRPIYLYPMALSFI----VTGV 121 Query: 122 IWQIYGRADIGLMGRMLQE--MGIEYSYTGNATQAWLTVLLMDVWHWTPLVALLAFAGLR 179 W+ + IGL M Q +++ + A TV++ VW + V + AGLR Sbjct: 122 AWKWFLDPGIGLENTMHQWGWESFSFNWIKDRNMAIYTVVIAAVWQSSGFVMAMFLAGLR 181 Query: 180 SIPDAYYQAARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPG 239 + + +AA+IDGAS ++R I +P MR V + A ++ + Y LTGGGPG Sbjct: 182 GVDNEIIKAAQIDGASTGMIYRRIIIPLMRPVFLSAFVVLAHLAIKAYDLVIALTGGGPG 241 Query: 240 NAT----TFLSQYLTTKAVGQFDLGPAAAFSLIYFFIILLLCFI 279 AT TF+ Y T+ +G ++A ++ +++ ++ Sbjct: 242 QATELPATFMYSYTFTR--NSMGIGASSAIIMLIMIFSIIIPYL 283 Lambda K H 0.328 0.140 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 292 Length adjustment: 26 Effective length of query: 272 Effective length of database: 266 Effective search space: 72352 Effective search space used: 72352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory