Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate WP_106713056.1 CU102_RS21035 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >NCBI__GCF_003010955.1:WP_106713056.1 Length = 355 Score = 200 bits (509), Expect = 4e-56 Identities = 122/352 (34%), Positives = 189/352 (53%), Gaps = 11/352 (3%) Query: 3 LALDSISKKVGAQTWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVD 62 + L +++K G+ L+D+SL + V +G + GK++L+R++AGLD P+ G +T+D Sbjct: 4 IKLTNVAKSFGSVDVLHDISLEIADSEFVVFVGPSGCGKSTLLRMIAGLDRPSRGELTID 63 Query: 63 GKDVTGMPVRDRNVAMVYQQFINYPSMKVAANIASPLK--LRGEKNIDARVREIASRLHI 120 GK V +P DR +AMV+Q + YP M V N+A L+ + I R+ E A L I Sbjct: 64 GKLVNNVPAADRGLAMVFQSYALYPHMSVRQNLAFGLENTKMPKAEIVERIAEAARMLEI 123 Query: 121 DMFLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAG 180 + +L+R P +LSGGQ+QRVA+ RA+ + LLDEPL NLD +LR R EL L A Sbjct: 124 EPYLERRPGQLSGGQRQRVAIGRAIVRRPVAFLLDEPLSNLDAELRGSTRAELAALHARL 183 Query: 181 QSTVVYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNLMA 240 +T++Y T + EA+ L VL G++ Q G E++++P + VA P MN + Sbjct: 184 SATMIYVTHDQVEAMTLADRIVVLRAGRVEQVGTPLELYNSPANRFVAGFIGSPHMNFLD 243 Query: 241 ASATAQG-----VRLQGGAELTLPLPQGAATAAGLTVGVRASALRVHARPGDVSVAGVVE 295 + + G V L GG + +P+ G A A +T+GVR + + + G + ++ Sbjct: 244 GTIESLGPSKAVVALTGGHRVEVPV-DGTAAGARVTLGVRPQHISIGDKQG---IPAEIK 299 Query: 296 LAEISGSDTFVHASTPWGDLVAQLTGVHYFELGTAITLHLDPAQAYVFGADG 347 L E GS+T +HA ++ G H G I L L A ++F G Sbjct: 300 LVEALGSETVLHADVAGQKVLVVAPGQHDLMAGAGIHLSLSAAPLHIFNEQG 351 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 355 Length adjustment: 29 Effective length of query: 334 Effective length of database: 326 Effective search space: 108884 Effective search space used: 108884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory