Align ABC transporter related (characterized, see rationale)
to candidate WP_106710773.1 CU102_RS07735 ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_003010955.1:WP_106710773.1 Length = 272 Score = 301 bits (770), Expect = 1e-86 Identities = 145/247 (58%), Positives = 193/247 (78%) Query: 8 ALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSL 67 A+ ++N+HK FG VLKG+S+ A GDV++++G SGSGKSTFLRC+N LE P G + + Sbjct: 22 AIHIENLHKRFGALEVLKGVSMSAKDGDVVAMIGGSGSGKSTFLRCINFLENPTSGVIRI 81 Query: 68 AGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRS 127 GE++KM G G P++RRQ++R+RS+LGMVFQNFNLW HMT+++N+IE P+ V Sbjct: 82 NGEDVKMVSDGHGGQVPANRRQIERIRSRLGMVFQNFNLWQHMTLIQNVIEVPVHVLGMK 141 Query: 128 RAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDP 187 R E++ E LL +VGL+ KR YPA++SGGQQQR AIARALA+ P+VMLFDEPTSALDP Sbjct: 142 RDEAMAIGEQLLERVGLSAKRDVYPAYMSGGQQQRGAIARALAIQPRVMLFDEPTSALDP 201 Query: 188 ELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVECKS 247 ELVGEVL+V+ LA+EGRTML+VTHEM FAR V++ VM+LH G VE +G P+++F KS Sbjct: 202 ELVGEVLKVIADLAKEGRTMLLVTHEMKFAREVASHVMYLHNGIVEEEGPPEQLFGSPKS 261 Query: 248 DRFRQFV 254 +R +QF+ Sbjct: 262 ERLKQFI 268 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 272 Length adjustment: 25 Effective length of query: 238 Effective length of database: 247 Effective search space: 58786 Effective search space used: 58786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory