Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate WP_106710622.1 CU102_RS08195 pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Query= curated2:P37942 (424 letters) >NCBI__GCF_003010955.1:WP_106710622.1 Length = 451 Score = 218 bits (555), Expect = 3e-61 Identities = 148/453 (32%), Positives = 230/453 (50%), Gaps = 54/453 (11%) Query: 6 MTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITELVGEEG 65 +TMP L ++ EG ++KWLV GDKV D IAE+ TDK EV + GT+ ++V G Sbjct: 5 ITMPALSPTMEEGNLAKWLVKEGDKVTSGDVIAEIETDKATMEVEAVDEGTVAKIVVPAG 64 Query: 66 -QTLQVGEMICKIETEGANPA------------------EQKQEQ----PAASEAAENP- 101 + ++V +I + EG + A E K E P A+EAA P Sbjct: 65 TEGVKVNALIAILAGEGEDAAAAAKGADAAPAKVEAPKQEAKAESAPAAPKAAEAAPTPT 124 Query: 102 --VAKSAGAADQPNKKRYSPAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQ 159 VA SA A N+ SP R+A + GIDL VTG+G GR+ +KD++ I GG + Sbjct: 125 PAVAPSAAPAQAGNRTFSSPLARRIAKDAGIDLAAVTGSGPHGRVVKKDVEAAIAGGGAK 184 Query: 160 EQNPEELKTAAPAPKSASKPEPK---------EETSYPASAAGDKEIPVTGVRKAIASNM 210 A PA SA+ P+P EE SY +P G+RK IA + Sbjct: 185 AAPAG----ATPAAASAAAPKPMSDDAVLKLFEEGSYDL-------VPHDGMRKTIAKRL 233 Query: 211 KRSKTEIPHAWTMMEVDVTNMVAYRNSIKDS--FKKTE-----GFNLTFFAFFVKAVAQA 263 +K+ +PH + ++ ++ ++A R I + +KTE + L+ +KA+A A Sbjct: 234 LEAKSTVPHFYLTLDCELDALLALRAQINAASPMRKTEKGDVPAYKLSVNDMIIKAMALA 293 Query: 264 LKEFPQMNSMWAGDKIIQKKDINISIAVATEDSLFVPVIKNADEKTIKGIAKDITGLAKK 323 L++ P+ N W +++ K ++ +AV+ L P+I+ A+EKT+ I+ ++ LAK+ Sbjct: 294 LRDVPEANVSWTDANMVKHKHSDVGVAVSIPGGLITPIIRRAEEKTLSAISNEMKDLAKR 353 Query: 324 VRDGKLTADDMQGGTFTVNNTGSFGSVQSMGIINYPQAAILQVESIVKRPVVMDNGMIAV 383 RD KL ++ QGGT V+N G FG IIN P A I+ + + +R VV G + V Sbjct: 354 ARDRKLKPEEYQGGTTAVSNLGMFGVKDFAAIINPPHATIIAIGAGEERAVV-KKGEVTV 412 Query: 384 RDMVNLCLSLDHRVLDGLVCGRFLGRVKQILES 416 ++++ LS DHR +DG + K+ +E+ Sbjct: 413 ATVMSVTLSTDHRAVDGALGAELAQAFKRHIEN 445 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 31 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 451 Length adjustment: 32 Effective length of query: 392 Effective length of database: 419 Effective search space: 164248 Effective search space used: 164248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory