Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate WP_106712687.1 CU102_RS19110 2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase
Query= curated2:P37942 (424 letters) >NCBI__GCF_003010955.1:WP_106712687.1 Length = 427 Score = 254 bits (648), Expect = 5e-72 Identities = 154/429 (35%), Positives = 233/429 (54%), Gaps = 32/429 (7%) Query: 5 QMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITELVGEE 64 ++ +P LGESV+E TI KW G+ + +P+ E+ TDKV EVP++ G++ E+ +E Sbjct: 4 EIRVPTLGESVSEATIGKWFKKVGEVIAVDEPLVELETDKVTIEVPAAAAGSLAEITAKE 63 Query: 65 GQTLQVGEMICKI---ETEGANPAEQKQEQPAASEA-----------AENPVAKSAG--- 107 G T++VG ++ I + A PA+Q+ + A ++A A A+ AG Sbjct: 64 GDTVEVGALLGMIGSGDGAAAAPAKQEAKPEAVAQASGAAAAATTSEAATKTAEVAGEPA 123 Query: 108 -AADQPNKKRYSPAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEEL 166 A +P++ SPA +L E G+ QV G+G G++ + D+ + G Sbjct: 124 IAERKPSEMPASPAASKLLAEKGVSPSQVEGSGKRGQVLKGDVLDAVAKG---------- 173 Query: 167 KTAAPAPKSASKPEPKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWTMMEV 226 PAP + + S A+ ++ + +T +R IA +K ++ T EV Sbjct: 174 ---IPAPATEAPAAVARPASSTDDASREERVKMTRLRLTIAKRLKDAQNSAAMLTTYNEV 230 Query: 227 DVTNMVAYRNSIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDIN 286 D++ ++ RN KD F+K G L F FF KAV ALKE P +N+ G II K + Sbjct: 231 DMSAVMDLRNRYKDIFEKKHGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIIYKNFAH 290 Query: 287 ISIAVATEDSLFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGS 346 + +AV T+ L VPV++NAD+ +I I K+I L + RDG L+ DMQGGTFT++N G Sbjct: 291 VGVAVGTDKGLVVPVVRNADQMSIAEIEKEIGRLGRAARDGALSMADMQGGTFTISNGGV 350 Query: 347 FGSVQSMGIINYPQAAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLDGLVCGRF 406 +GS+ S I+N PQ+ IL + I RPVV+ G I +R M+ L LS DHR++DG F Sbjct: 351 YGSLMSSPILNAPQSGILGMHKIQDRPVVV-GGQIVIRPMMYLALSYDHRIVDGKEAVTF 409 Query: 407 LGRVKQILE 415 L RVK+ LE Sbjct: 410 LVRVKESLE 418 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 427 Length adjustment: 32 Effective length of query: 392 Effective length of database: 395 Effective search space: 154840 Effective search space used: 154840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory