Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_106712562.1 CU102_RS18480 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::Q1D5Y4 (258 letters) >NCBI__GCF_003010955.1:WP_106712562.1 Length = 259 Score = 149 bits (375), Expect = 7e-41 Identities = 97/257 (37%), Positives = 130/257 (50%), Gaps = 4/257 (1%) Query: 2 PEFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFC 61 P +V GP+ T+ + NA MLK+L V ++ DVR ++TGAG KAF Sbjct: 4 PRIEVTFAGPVATITVSRPEKLNAFDIDMLKDLSAACDTVEANLDVRVTILTGAG-KAFS 62 Query: 62 AGADLKERATMAEDEV-RAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLR 120 AG D+ A M +E A++ R F + IAA+NG ALGGG ELA A D+R Sbjct: 63 AGGDINAWAAMTPNEFGHAWVRFGHRVFERLATLRMPLIAALNGHALGGGLELAAAADIR 122 Query: 121 VAAPAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRL 180 +A LGL E LG++PG GTQRL R G + + L +A E +GL + + Sbjct: 123 IAETQIRLGLPETGLGMVPGWSGTQRLVRRFGAQVVRRMALGGEIFSATEGLGLGLIDHV 182 Query: 181 APEGHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDR 240 G + A AE + + P AV AK I G D+ A+E + KT D Sbjct: 183 VETGAAVNAAQTHAERIAKRGPAAVEVAKLMIAVANG--EDNGTAVEALGSILVAKTADL 240 Query: 241 LEGLRAFAEKRAPVYKG 257 EG+ AFAEKR PV+KG Sbjct: 241 KEGVSAFAEKREPVFKG 257 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory