Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_106713519.1 CU102_RS23530 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_003010955.1:WP_106713519.1 Length = 278 Score = 175 bits (444), Expect = 7e-49 Identities = 101/239 (42%), Positives = 149/239 (62%), Gaps = 8/239 (3%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 LL + +V + + +L+GI+ + G++ ++G NGAGKST K I GLL GEI Sbjct: 20 LLSINNVEVIFNGVILVLRGISLNARKGKITALLGANGAGKSTTLKAIAGLLRTDDGEIT 79 Query: 64 -----FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPT-QTLKD 117 + G ++T D+ VR G+ V + + +T+ +NL +GAF G +T + Sbjct: 80 RGSVTYDGRDVTHTPPDRKVRDGVFLVMEGRGIIQDMTIRDNLRLGAFTRPGANVETEIE 139 Query: 118 RIYTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFA 177 IY FP+L +R+ AG LSGGE+QMLA+GRA+M P L+++DEPS LSP+LVK+VF Sbjct: 140 EIYRFFPRLKERKGL-AGYLSGGEQQMLAIGRAMMAKPRLIMMDEPSMGLSPLLVKEVFG 198 Query: 178 QIKAIN-ATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLG 235 I+ +N G +I+LVEQNA AL ++D GY++ENG+ L+GS + LL + V E YLG Sbjct: 199 IIRRLNRELGISILLVEQNANMALKISDYGYIMENGKIVLDGSAEELLQNEDVKEFYLG 257 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 278 Length adjustment: 24 Effective length of query: 216 Effective length of database: 254 Effective search space: 54864 Effective search space used: 54864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory