Align 3-keto-5-aminohexanoate cleavage enzyme (EC 2.3.1.247) (characterized)
to candidate WP_106710555.1 CU102_RS07810 3-keto-5-aminohexanoate cleavage protein
Query= BRENDA::Q8RHX2 (272 letters) >NCBI__GCF_003010955.1:WP_106710555.1 Length = 301 Score = 158 bits (400), Expect = 1e-43 Identities = 100/293 (34%), Positives = 162/293 (55%), Gaps = 25/293 (8%) Query: 4 KLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVREDD-GTPTQDKE 62 ++ IT A+ GA T + VP T +IA E +A AGA+I H+HVR+ G ++D Sbjct: 8 EVFITCAVTGAGDTTGRSDKVPVTPRQIADECIAAANAGAAIAHIHVRDPKTGKGSRDVA 67 Query: 63 RFRKCIEAIREKCPDVIIQPSTG-------GAVGM--------TDL----ERLQPT-ELH 102 + + +E I+ D+++ + G G+V TD+ ERL+ +L Sbjct: 68 LYAEVVEHIKASGVDMVLNLTAGMGGDLTLGSVEQPMPPSPNGTDMAGATERLEHVAKLR 127 Query: 103 PEMATLDCGTCNFG-GDEIFVNTENTIKNFGKILIERGVKPEIEVFDKGMIDYAIRYQKQ 161 PE+ TLDCGT NFG GD + NT +K + GV+PE+E+FD G + A Q Sbjct: 128 PEICTLDCGTMNFGEGDYVMTNTPAMLKAMAAQIKALGVRPEVEIFDTGHLLLAKWLYDQ 187 Query: 162 GFIQKPMHFDFVLGVQMSA--SARDLVFMSESIPEGSTWTVAGVGRHQFQMAALAIVMGG 219 ++ P+ +G+ A L+ ++ ++P T++ +GR+Q AA+A++ GG Sbjct: 188 KLLEDPVMVQLCMGIPWGAPDDINTLLALTNNLPSNWTFSAFSIGRNQMPYAAMAMLAGG 247 Query: 220 HVRVGFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSLKK 272 ++RVG ED +++DKG+LA +NG LVER V++A+ +G I P+E R+ + L K Sbjct: 248 NIRVGLEDTIWLDKGVLA-TNGPLVERAVKVAEGMGARILGPNEVRERMKLTK 299 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 301 Length adjustment: 26 Effective length of query: 246 Effective length of database: 275 Effective search space: 67650 Effective search space used: 67650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory