Align glucokinase (EC 2.7.1.2) (characterized)
to candidate WP_106710140.1 CU102_RS06135 ROK family protein
Query= reanno::SB2B:6938110 (299 letters) >NCBI__GCF_003010955.1:WP_106710140.1 Length = 304 Score = 146 bits (368), Expect = 7e-40 Identities = 102/297 (34%), Positives = 145/297 (48%), Gaps = 13/297 (4%) Query: 7 DLGGTKIE--LVALGEDGSELFRKRIATP-REYQGTLNAVVTLVNEAEATLGTQGSL-GI 62 D+GG+ I+ + ED L ++ TP ++ A+ + + A Q SL I Sbjct: 6 DIGGSAIKGAIAHSPEDIRPL--PKVQTPLHDFDAFAGAIEKIAADGGAD---QASLISI 60 Query: 63 GIPGVISPYTGLVKNANSTWINGHPLDRDLGALLNREVRVANDANCFAVSEAVDGAAAGK 122 I GV+ TG + AN I+G L DL L+R V VANDA+CFA+SEAV GA G Sbjct: 61 SIAGVVDADTGKITCANIPCIHGRKLVDDLSEKLHRPVLVANDADCFALSEAVVGAGRGH 120 Query: 123 RVVFGAILGTGCGAGLAFDGRVHEGGNGIGGEWGHNP----LPWMRPDEFNTTECFCGNK 178 RVVFG ILGTG G G+ +G++HEG G GEWGH P L P C CG Sbjct: 121 RVVFGVILGTGVGGGIVINGKIHEGAGGFAGEWGHGPVSATLAGNPPVAIPRLACGCGQI 180 Query: 179 DCIETFVSGTGFVRDFRNSGGTAQNGAEIMSLVDAGDELANLVFDRYLDRLARSLAHVIN 238 CI+ + G + + G EI+ +AGD A D Y+D ++ LA IN Sbjct: 181 GCIDAIGAARGMEKLHAHLHGVNLPSTEIIERWNAGDTAAERTVDCYIDIVSGPLAMTIN 240 Query: 239 MLDPDAIVLGGGMSNVQAIYARLPAILPKYVVGRECRTPVVQNLYGCSSGVRGAAWL 295 ++ + +GGG++N + RL + ++ + + VV G+ GA L Sbjct: 241 VVGASIVPVGGGLANSVPLIQRLDEAVRSRILRKTDKPLVVPAELKIEPGLIGAGVL 297 Lambda K H 0.320 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 304 Length adjustment: 27 Effective length of query: 272 Effective length of database: 277 Effective search space: 75344 Effective search space used: 75344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory