Align glucokinase (EC 2.7.1.2) (characterized)
to candidate WP_106713292.1 CU102_RS22250 ROK family transcriptional regulator
Query= BRENDA::B1VZT1 (313 letters) >NCBI__GCF_003010955.1:WP_106713292.1 Length = 404 Score = 72.0 bits (175), Expect = 2e-17 Identities = 62/181 (34%), Positives = 85/181 (46%), Gaps = 24/181 (13%) Query: 83 WRHEPLKDKVEQRVGLPVVVENDANAAAWGEYRFGAGQGHDDVICITLGTGLGGGIIIGN 142 W++ PL D++ + GL V ++NDA AAA E GA G D ICI G GLG G+I+ Sbjct: 180 WQNFPLIDRIAEGTGLEVALQNDAAAAATAERLLGAAHGLDHAICIYFGYGLGTGLILNG 239 Query: 143 KLRRGRFGVAAEFGHI-RVVP-DGLLCGCGSQGCWEQYASGRALVRYAKQRANATPENAA 200 +L G A E G I +VP DGL E YAS AL + Sbjct: 240 ELYGGAHSNAGEIGMILALVPGDGL-----DVEPLEHYASMAALCK-------------- 280 Query: 201 VLLGLGDGSVDGIEGKHISEAARQGDPVAVDSFRELARWAGAGLADLASLFDPSAFIVGG 260 LL L D S + G+ +++A G P + +A+ + L S+FDP I+ G Sbjct: 281 -LLNL-DPSEPELFGQ-VTDALMHGGPKLDEWIGNVAQRLRRTVQALESIFDPQTIILCG 337 Query: 261 G 261 G Sbjct: 338 G 338 Lambda K H 0.319 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 404 Length adjustment: 29 Effective length of query: 284 Effective length of database: 375 Effective search space: 106500 Effective search space used: 106500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory