Align SmoG, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_106709805.1 CU102_RS04540 carbohydrate ABC transporter permease
Query= TCDB::O30833 (276 letters) >NCBI__GCF_003010955.1:WP_106709805.1 Length = 317 Score = 169 bits (429), Expect = 5e-47 Identities = 101/306 (33%), Positives = 161/306 (52%), Gaps = 37/306 (12%) Query: 4 RTSTRRTLIVTLAAWTIAFLIFFPILWTVLMSFKSEGDAIKAPFAMLFSDWTLQSYAD-- 61 RTS R + +A A + P++W VL SFKS D+I P ++F TL+ Y + Sbjct: 15 RTSKRIAATIVIA---YAVITMIPLVWIVLTSFKSPPDSISYPPKIVFQP-TLEGYCNLF 70 Query: 62 -------------------------------VQERSNYARHFMNSVVISLGSTLVALAIA 90 + SNY F NS+VI+ GST +A+++ Sbjct: 71 TTRTRQTSEYITSLGAPTSTCDEITRSRNMVIAGPSNYWPRFQNSLVIAFGSTFLAVSLG 130 Query: 91 IPAAWAMAFVPGRRTKDVLMWMLSTKMMPAVGVLIPLYLIFRDTGLLDTRIGLVIVLTLI 150 AA+ + +D+L ++LST+MMP + V IP+YL++R+ GL DT +G++++ T + Sbjct: 131 TLAAYGFSRFKVPLAEDLLFFILSTRMMPPIAVAIPIYLMYRELGLSDTALGMILLYTAV 190 Query: 151 NLPIVVWMLYTYFKEIPGEILEAARMDGATLGSEILYILTPMAVPGIASTLLLNVILAWN 210 N+ + VW+L + EIP E EAA +DG T ++ P A GIA+T + +I AWN Sbjct: 191 NVSLAVWLLKGFIDEIPREYEEAAMIDGYTRMQAFFKVVLPQATTGIAATAIFCLIFAWN 250 Query: 211 EAFWTLQLTTSRAAPLTQFIASYSSPEGLFYAKLSAASTMAIAPILILGWFSQKQLVRGL 270 E + + LT+ A FI + G + ++A +T+ + PIL+ +KQL+RG+ Sbjct: 251 EYAFAVLLTSGAAQTAPPFIPTIIGEGGQDWPAVAAGTTIFVVPILVFTILLRKQLLRGI 310 Query: 271 TFGAVK 276 TFGAV+ Sbjct: 311 TFGAVR 316 Lambda K H 0.327 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 276 Length of database: 317 Length adjustment: 26 Effective length of query: 250 Effective length of database: 291 Effective search space: 72750 Effective search space used: 72750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory