Align SmoG, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_106712311.1 CU102_RS17065 carbohydrate ABC transporter permease
Query= TCDB::O30833 (276 letters) >NCBI__GCF_003010955.1:WP_106712311.1 Length = 276 Score = 433 bits (1113), Expect = e-126 Identities = 212/276 (76%), Positives = 239/276 (86%) Query: 1 MSRRTSTRRTLIVTLAAWTIAFLIFFPILWTVLMSFKSEGDAIKAPFAMLFSDWTLQSYA 60 M+R +TRR + T+ W I LIFFPILWT L SFK+EG A+ P LF DWTL++Y Sbjct: 1 MARAVTTRRKMTFTIIGWAIGLLIFFPILWTFLTSFKTEGTAVATPPQFLFFDWTLENYH 60 Query: 61 DVQERSNYARHFMNSVVISLGSTLVALAIAIPAAWAMAFVPGRRTKDVLMWMLSTKMMPA 120 +VQ RSNY +H NSVVIS+GSTL+ LA+AIP AWAMAF P +RTKDVLMWMLSTKMMP Sbjct: 61 EVQSRSNYMKHVTNSVVISVGSTLIGLALAIPVAWAMAFSPTKRTKDVLMWMLSTKMMPP 120 Query: 121 VGVLIPLYLIFRDTGLLDTRIGLVIVLTLINLPIVVWMLYTYFKEIPGEILEAARMDGAT 180 VGVL+PLYLIFRD GLLDTR+GLV VLT+INLPI+VWMLYTYFKEIPGEILEAARMDGA+ Sbjct: 121 VGVLVPLYLIFRDWGLLDTRLGLVAVLTMINLPIIVWMLYTYFKEIPGEILEAARMDGAS 180 Query: 181 LGSEILYILTPMAVPGIASTLLLNVILAWNEAFWTLQLTTSRAAPLTQFIASYSSPEGLF 240 L EI+Y+LTPMAVPGIAST+LLN+ILAWNEAFWTL L+ + AAPLT FIASYSSPEGLF Sbjct: 181 LMKEIVYVLTPMAVPGIASTMLLNIILAWNEAFWTLNLSAANAAPLTAFIASYSSPEGLF 240 Query: 241 YAKLSAASTMAIAPILILGWFSQKQLVRGLTFGAVK 276 +AKLSAASTMAIAPILI+GWFSQKQLVRGLTFGAVK Sbjct: 241 WAKLSAASTMAIAPILIMGWFSQKQLVRGLTFGAVK 276 Lambda K H 0.327 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 276 Length adjustment: 25 Effective length of query: 251 Effective length of database: 251 Effective search space: 63001 Effective search space used: 63001 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory