Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_106712846.1 CU102_RS19975 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >NCBI__GCF_003010955.1:WP_106712846.1 Length = 336 Score = 282 bits (722), Expect = 7e-81 Identities = 142/306 (46%), Positives = 200/306 (65%), Gaps = 2/306 (0%) Query: 17 VDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFF 76 + LK + I+ A+DG+ + I++GE +GLVGESGCGKSTLGR I + P G I + Sbjct: 28 IALKLKLARPASIVHALDGVDLTIQKGEVVGLVGESGCGKSTLGRVIAGITSPSEGSILW 87 Query: 77 EGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRV 136 EG+D + ++ Q+IFQ+P+ +LNP+MTV +I + H + ERR V Sbjct: 88 EGEDRATMPTEKRHRLGLITQMIFQNPMAALNPRMTVDELIWEAPSTHGFARRSERRDYV 147 Query: 137 EELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQII 196 ++ L + G +PH+FSGGQ+QR+ IARALA+ PKF+VCDE V+ALDVSIQAQ++ Sbjct: 148 DKYLRLAGFDPAMKTRYPHQFSGGQRQRVNIARALAVQPKFLVCDESVAALDVSIQAQVL 207 Query: 197 DLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRAL 256 +L E++ K+ ++YLF++H+L VVEHIS +VA+MYLG+IVE V++IF P HPYT+AL Sbjct: 208 NLFMELRDKLDLTYLFVSHDLGVVEHISDRVAIMYLGRIVEEAPVEEIFKRPNHPYTQAL 267 Query: 257 LKSVPKIPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNH 316 L VP+I + K+RF +KGELPSP++ P GC F RC C P E+ H Sbjct: 268 LAEVPRI--ESGKRRFQVVKGELPSPLNPPTGCHFHPRCPFAMDRCRIDAPVKREIAPGH 325 Query: 317 FVSCHL 322 +CHL Sbjct: 326 MSACHL 331 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 336 Length adjustment: 28 Effective length of query: 300 Effective length of database: 308 Effective search space: 92400 Effective search space used: 92400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory