Align Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate WP_106712566.1 CU102_RS18500 carbohydrate ABC transporter permease
Query= TCDB::Q72KX4 (268 letters) >NCBI__GCF_003010955.1:WP_106712566.1 Length = 293 Score = 259 bits (661), Expect = 6e-74 Identities = 136/277 (49%), Positives = 182/277 (65%), Gaps = 11/277 (3%) Query: 3 RALLYGFLLLMAGFFLLPVYLVVLTALKEPARIT----LETVWQWPHPPYWESFRTAW-- 56 RAL+Y LL A ++LLP+Y++V+ +LK I L +W P+ ++ TA Sbjct: 17 RALIYTALLFFAFYYLLPLYVMVVNSLKPLDEIRQGGMLSPPREWTIEPWLSAWSTAQIG 76 Query: 57 ---EAFRPKFQNSVVLAVSATLLSALVGSLNGYVLAKWPFRGSGLLFALILFGMFIPYQS 113 RP F NS+++ V A +S +VG+LNGYVL KW F GS L+F ++L G FIP+Q Sbjct: 77 VQPTGLRPYFINSIIMVVPAVAISTIVGALNGYVLTKWRFPGSNLMFGMLLLGCFIPFQI 136 Query: 114 ILIPLFQFMKSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDELVEAARIDGAGFF 173 +LIP+ + + GL G++ GL+LVHVIYG+ TL FRNYY P ELV AA+IDGA FF Sbjct: 137 VLIPMARMLGLFGLAGTIQGLILVHVIYGLGFTTLYFRNYYEAFPTELVRAAQIDGASFF 196 Query: 174 GIFRHVILPLSVPAFVVVAIWQFTQIWNEFLFAVTLTRPESQPITVALAQLAGGE--AVK 231 IFR ++LP S P VV IWQFT IWN+FLF + + S P+TVAL L + Sbjct: 197 QIFRRILLPSSGPIIVVSVIWQFTNIWNDFLFGASFSGFNSTPMTVALNNLVNSSTGVKE 256 Query: 232 WNLPMAGAILAALPTLLVYILLGRYFLRGLLAGSVKG 268 +N+ AGAILAALPTL+VYI+ GRYF+RGL++G+VKG Sbjct: 257 YNVHFAGAILAALPTLIVYIVSGRYFVRGLMSGAVKG 293 Lambda K H 0.330 0.146 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 293 Length adjustment: 26 Effective length of query: 242 Effective length of database: 267 Effective search space: 64614 Effective search space used: 64614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory