Align BadH (characterized)
to candidate WP_106713190.1 CU102_RS21700 acetoacetyl-CoA reductase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_003010955.1:WP_106713190.1 Length = 241 Score = 169 bits (428), Expect = 5e-47 Identities = 100/245 (40%), Positives = 139/245 (56%), Gaps = 11/245 (4%) Query: 7 KTAVITGGGGGIGGATCRRFAQEGAKIAV-FDLNLDAAEKVAGAIRDAGGTAEAVRCDIA 65 KTA++TGG GIG A G +A + N DAA+K + G + D++ Sbjct: 3 KTAIVTGGTRGIGAAISVALKAAGYNVAANYAGNDDAAKKFT---TETG--IPTYKWDVS 57 Query: 66 DRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHHAV 125 + A IA +GPV +LVNNAG F K PG+W +I NLTG +M H V Sbjct: 58 NYEECAAGIARIEADIGPVAVLVNNAGITRDAMFHKMTPGQWGEVINTNLTGLFNMTHPV 117 Query: 126 LPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVVCP 185 GM +R+ GR++NI+S + G +G+A Y+A K G + F+K LA+E AR GITVN +CP Sbjct: 118 WSGMRDRKFGRVINISSINGQKGQAGQANYSAAKAGDIGFTKALAQEGARAGITVNAICP 177 Query: 186 GPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITGQVL 245 G T ++ A + + L E IP+GRLG+P+++A + F SDDAGFITG L Sbjct: 178 GYIGTEMVR-----AIDQKVLNERIIPQIPVGRLGEPEEVARCVVFLASDDAGFITGSTL 232 Query: 246 SVSGG 250 S +GG Sbjct: 233 SANGG 237 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 241 Length adjustment: 24 Effective length of query: 231 Effective length of database: 217 Effective search space: 50127 Effective search space used: 50127 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory