Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate WP_106714347.1 CU102_RS28265 FAD-binding oxidoreductase
Query= reanno::pseudo6_N2E2:Pf6N2E2_80 (394 letters) >NCBI__GCF_003010955.1:WP_106714347.1 Length = 328 Score = 189 bits (480), Expect = 1e-52 Identities = 106/328 (32%), Positives = 176/328 (53%), Gaps = 3/328 (0%) Query: 25 LEAAKVGFGASGRNGGQIVNSYSRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQ 84 LEA ++G+GASGRNGG + Y+ D D IER+VG A+ L ++ EG + +R+ + + Sbjct: 1 LEAERIGWGASGRNGGFVSPGYANDGDAIERAVGADHARKLHALSIEGMKFVRDTIDELD 60 Query: 85 IQCDLKDGGVFAALTAKQMGHLESQKRLWERFGHTQLELLDQRRIREVVACEEYVGGMLD 144 I G+ + L + L ++ +R +E + + +++ V+ + Y + D Sbjct: 61 IVAAAPTHGIMSVLRYENSQALLARADYLQREFDYSVEYMSRDQVQNVLRSKRYFQALRD 120 Query: 145 MSGGHIHPLNLALGEAAAVESLGGVIYEQSPAVRIERGAS-PVVHTPQGKVRAKFIIVAG 203 HIHPLN A + LGG I+E SPA+ + S +V T +G++R + +IVA Sbjct: 121 PQAFHIHPLNYLRSAAREIRRLGGKIFEGSPALSCDFSRSEKIVRTARGEIRTRRVIVAS 180 Query: 204 NAYLGNLVPELAAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYR-LTGDK 262 Y L+P++ +P T V+ TE D + ++ D V D DYYR + G K Sbjct: 181 GGYTTGLIPKMKRSFLPIATYVMMTEEAPDLIRQAITTTD-AVGDNRRAGDYYRVIEGGK 239 Query: 263 RLIFGGGVVYGARDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLG 322 RL++GG + A PA + + +M + +PQL D+KI+ +W+G +PQ+G+L Sbjct: 240 RLLWGGRITTRAASPAALAVELHREMARTYPQLADLKIETSWSGLMSYARHLMPQIGQLH 299 Query: 323 DNIYYSQGCSGHGVTYTHLAGKVLAEAL 350 +++Y GHG+ T + GKV+AEA+ Sbjct: 300 SDVWYCTAFGGHGLNTTAIGGKVIAEAI 327 Lambda K H 0.321 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 328 Length adjustment: 29 Effective length of query: 365 Effective length of database: 299 Effective search space: 109135 Effective search space used: 109135 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory