Align RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate WP_106709787.1 CU102_RS04475 sugar ABC transporter ATP-binding protein
Query= TCDB::Q7BSH4 (512 letters) >NCBI__GCF_003010955.1:WP_106709787.1 Length = 514 Score = 376 bits (965), Expect = e-108 Identities = 201/495 (40%), Positives = 319/495 (64%), Gaps = 6/495 (1%) Query: 20 ILEMRGISQIFPGVKALDNVSIALHPGTVTALIGENGAGKSTLVKILTGIYRPNEGEILV 79 +L +R +++ F VKAL NV+ AL G V AL GENGAGKSTL+ I+ G+ +P+EGEI++ Sbjct: 5 VLSIRNVTKHFGAVKALTNVNFALERGEVHALCGENGAGKSTLMNIIAGVLQPDEGEIVL 64 Query: 80 DGRPTTFASAQAAIDAGVTAIHQETVLFDELTVAENIFLGHAPRTRFRTIDWQTMNSRSK 139 DG+ S AA G+ +HQE L + +VAENIF+ R R ++++ + ++ Sbjct: 65 DGKTVRIGSPAAAQSLGLGLVHQEIALCPDASVAENIFMASISRQRSLLMNYRKLEREAQ 124 Query: 140 ALLTALESNIDPTIRLKDLSIAQRHLVAIARALSIEARIVIMDEPTAALSRKEIDDLFRI 199 A+++ L + ID ++ +L I+ + LV IA+AL+++ R++I DEPTAAL+ E LF I Sbjct: 125 AVMSRL-APIDVRRKVGELPISSQQLVEIAKALTLDCRVLIFDEPTAALTEAEARILFEI 183 Query: 200 VRGLKEQGKAILFISHKFDELYEIADDFVVFPRRSRRPVRGVSRKTPQDEIVRMMVGRDV 259 +R LK G +I++ISH+ E++E+ D V V+ TP D++VR MVGR++ Sbjct: 184 IRDLKANGISIVYISHRMAEIFELCDRVTVLRDGRYVSTDRVADLTP-DDVVRRMVGREI 242 Query: 260 ENVFPKIDVAIGGP---VLEIRNYSHRTEFRDISFTLRKGEILGVYGLIGAGRSELSQSL 316 ++P A P V +R FRD+ L +GEILG+ GLIG+GR+E+++ + Sbjct: 243 TQLYPPKQPAGERPQEVVFSVRGLGDNERFRDVDIDLTRGEILGIGGLIGSGRTEIAEGI 302 Query: 317 FGITKPLSGKMVLEGQEITIHSPQDAIRAGIVYVPEERGRHGLALPMPIFQNMTLPSL-A 375 G+ +G++++ G++ I + DA++AG+VY+ E+R GL L + I +N+++ +L A Sbjct: 303 CGLRATTNGQILIHGKQQAIGTYADAVKAGLVYLSEDRKGSGLFLDLSIAKNISVLNLDA 362 Query: 376 RTSRRGFLRAANEFALARKYAERLDLRAAALSVPVGTLSGGNQQKVVIGKWLATAPKVII 435 T G + E LAR +A+RL++R ++ PV +LSGGNQQKV I K LA PKVI+ Sbjct: 363 LTGHLGLIDTVGEGDLARDFAQRLNIRMGSIGAPVSSLSGGNQQKVAIAKQLAIQPKVIL 422 Query: 436 LDEPTKGIDIGSKAAVHGFISELAAEGLSIIMVSSELPEIIGMSDRVLVMKEGLSAGIFE 495 +DEPT+GID+G+K+ +H + ELA G+ II++SSELPE++G+ DRV+V++EG AG Sbjct: 423 MDEPTRGIDVGAKSEIHALLRELAQSGIGIIVISSELPELLGLCDRVIVIREGEVAGELG 482 Query: 496 RAELSPEALVRAATG 510 +++ E ++R A+G Sbjct: 483 MDDMTEERVIRLASG 497 Lambda K H 0.320 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 609 Number of extensions: 34 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 512 Length of database: 514 Length adjustment: 35 Effective length of query: 477 Effective length of database: 479 Effective search space: 228483 Effective search space used: 228483 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory