Align ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate WP_106714415.1 CU102_RS28780 ABC transporter permease
Query= TCDB::Q9X050 (331 letters) >NCBI__GCF_003010955.1:WP_106714415.1 Length = 342 Score = 213 bits (542), Expect = 6e-60 Identities = 121/312 (38%), Positives = 187/312 (59%), Gaps = 18/312 (5%) Query: 22 IFILLGLIVLFSFLSNRF------LTLENFWIILRQTAVNLCIAVGMTFVILTGGIDLSV 75 + +L+G+ ++F L F + + II+ Q +V IAVG+T VI+TGGIDLS Sbjct: 30 LLVLIGIALIFEILGWIFAGQSFLMNFQRLRIIILQVSVIGIIAVGVTQVIITGGIDLSS 89 Query: 76 GSILGFSGAVTAKLLKYGL----ILSAFGVVLKFNPLGASIIGVLAGFAIGLFNGFIITR 131 GS++G + + A + + A + F P+G +G+ G G+ NG++I Sbjct: 90 GSVVGMTAMIAASFAQSSTWARPVYPALTDLPFFIPIG---VGLGIGLLAGIVNGWLIAY 146 Query: 132 FNIPPFVATLGTMTAVRGFIMLLTKGHPITRLGDSFDFIGSGWFLGIPMPVWIAAIATGV 191 IPPF+ATLG M + RG TKG P++ L D F FIG+ + PV + + + Sbjct: 147 TKIPPFIATLGMMVSARGVAKWYTKGSPVSGLTDQFTFIGASIW-----PVVVFLLVALI 201 Query: 192 GIFILRKTQFGRYVYAVGGNEKAAVLSGVNSKLTKLWVYAISGILSAVAGLIVTARLDSA 251 LR T++G++ YA+G N +AA +SG++ + + VYAI+G+L+ +AG++ AR +A Sbjct: 202 FHVALRYTRYGKFTYAIGANLQAARVSGIDIERHLIKVYAIAGLLAGLAGIVTAARAQTA 261 Query: 252 QPNAGLMYELDAIAATVIGGASLSGGKGTLIGTVVGALIIGVLNDGLVLVGVSPFWQQVA 311 Q G+ YELDAIAA VIGG SL+GG G + GTV+GA+I+GV+ G + V ++Q++ Sbjct: 262 QAGMGVTYELDAIAAAVIGGTSLTGGIGRITGTVIGAIILGVMISGFTFLRVDAYYQEII 321 Query: 312 KGFIIIAAVIAE 323 KG II+AAVI + Sbjct: 322 KGVIIVAAVIVD 333 Lambda K H 0.327 0.144 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 342 Length adjustment: 28 Effective length of query: 303 Effective length of database: 314 Effective search space: 95142 Effective search space used: 95142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory