Align ABC transporter for D-sorbitol, ATPase component (characterized)
to candidate WP_106713056.1 CU102_RS21035 ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_1960 (365 letters) >NCBI__GCF_003010955.1:WP_106713056.1 Length = 355 Score = 357 bits (917), Expect = e-103 Identities = 184/355 (51%), Positives = 246/355 (69%), Gaps = 3/355 (0%) Query: 1 MATLKIENLKKGFEGLSIIKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSGTI 60 M +K+ N+ K F + ++ I LE+ D EFVVFVGPSGCGKSTLLR+IAGL+ + G + Sbjct: 1 MGHIKLTNVAKSFGSVDVLHDISLEIADSEFVVFVGPSGCGKSTLLRMIAGLDRPSRGEL 60 Query: 61 ELDGRDITEVTPAKRDLAMVFQTYALYPHMTVRKNLSFALDLAGEKKPDVERKVAEAARI 120 +DG+ + V A R LAMVFQ+YALYPHM+VR+NL+F L+ K ++ ++AEAAR+ Sbjct: 61 TIDGKLVNNVPAADRGLAMVFQSYALYPHMSVRQNLAFGLENTKMPKAEIVERIAEAARM 120 Query: 121 LELGSLLDRKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSRLH 180 LE+ L+R+P QLSGGQRQRVAIGRAIVR P FL DEPLSNLDA LR TR EL+ LH Sbjct: 121 LEIEPYLERRPGQLSGGQRQRVAIGRAIVRRPVAFLLDEPLSNLDAELRGSTRAELAALH 180 Query: 181 KELQATMIYVTHDQVEAMTLATKVVVLNAGRIEQIGSPLELYHHPANLFVAGFLGTPKMG 240 L ATMIYVTHDQVEAMTLA ++VVL AGR+EQ+G+PLELY+ PAN FVAGF+G+P M Sbjct: 181 ARLSATMIYVTHDQVEAMTLADRIVVLRAGRVEQVGTPLELYNSPANRFVAGFIGSPHMN 240 Query: 241 FLQATVHAVHASGVEVRFASGTTLLIPRDSSALSVGQSVTIGIRPEHLTLSAEGQVPVTT 300 FL T+ ++ S V G + +P D +A G VT+G+RP+H+++ + +P Sbjct: 241 FLDGTIESLGPSKAVVALTGGHRVEVPVDGTA--AGARVTLGVRPQHISIGDKQGIPAEI 298 Query: 301 DVTERLGSDTFCHVNVDSGESLTVRVQGDCEVPYAARRYLTLDVAHCHLFDESGL 355 + E LGS+T H +V +G+ + V G ++ A +L+L A H+F+E GL Sbjct: 299 KLVEALGSETVLHADV-AGQKVLVVAPGQHDLMAGAGIHLSLSAAPLHIFNEQGL 352 Lambda K H 0.319 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 355 Length adjustment: 29 Effective length of query: 336 Effective length of database: 326 Effective search space: 109536 Effective search space used: 109536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory