Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_106713056.1 CU102_RS21035 ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_003010955.1:WP_106713056.1 Length = 355 Score = 325 bits (832), Expect = 2e-93 Identities = 182/356 (51%), Positives = 232/356 (65%), Gaps = 7/356 (1%) Query: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 M +KLT V K++G V VL +I+L+I E +VFVGPSGCGKSTLLRMIAGL++ + G L Sbjct: 1 MGHIKLTNVAKSFGSVDVLHDISLEIADSEFVVFVGPSGCGKSTLLRMIAGLDRPSRGEL 60 Query: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 IDG +VN+VP A RG+AMVFQSYALYPHM+VR+N++F L+ K +AEI + AA Sbjct: 61 TIDGKLVNNVPAADRGLAMVFQSYALYPHMSVRQNLAFGLENTKMPKAEIVERIAEAARM 120 Query: 121 LQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLK 180 L++ YL+R P LSGGQRQRVAIGR+IVR P +L DEPLSNLDA LR +TR E+A L Sbjct: 121 LEIEPYLERRPGQLSGGQRQRVAIGRAIVRRPVAFLLDEPLSNLDAELRGSTRAELAAL- 179 Query: 181 EAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKM 240 A +TM+YVTHDQVEAMTLA RIVVL G + QVG+PLELY P N FVA FIGSP M Sbjct: 180 HARLSATMIYVTHDQVEAMTLADRIVVLRAGRVEQVGTPLELYNSPANRFVAGFIGSPHM 239 Query: 241 NLLPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPGGDYVFE 300 N L G I G V GG V + P D + GA V +GVRP+ + + G Sbjct: 240 NFLDGTIESLGPSKAVVALTGGHRV-EVPVDGTAAGARVTLGVRPQHI---SIGDKQGIP 295 Query: 301 GKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIHKDLKGQVTRLTAEPAKVHVFKD 356 ++ + EALG T+L+ + + + G H + G L+ A +H+F + Sbjct: 296 AEIKLVEALGSETVLHADVAGQKVLVVA--PGQHDLMAGAGIHLSLSAAPLHIFNE 349 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 355 Length adjustment: 29 Effective length of query: 344 Effective length of database: 326 Effective search space: 112144 Effective search space used: 112144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory