Align Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_106713055.1 CU102_RS21030 carbohydrate ABC transporter permease
Query= uniprot:A0A165KQ00 (289 letters) >NCBI__GCF_003010955.1:WP_106713055.1 Length = 350 Score = 108 bits (271), Expect = 1e-28 Identities = 63/209 (30%), Positives = 117/209 (55%), Gaps = 5/209 (2%) Query: 81 FFMNSVAMAVPAVLISTVWGALNGYVLSLWKFRGSDALFGMLLFGVFMPFQVVLLPMSQV 140 + NSV + V A LI+ + ++ + LS ++FRG ++L + +P V+++P+ + Sbjct: 146 YLWNSVFVTVVATLITLIVNSMAAFALSKYEFRGRTIAMLLILATLMVPLSVIMVPLYSI 205 Query: 141 LGWLGLSSSITGLVLVHCLAGLAGTTLFFRNYYAAIPKELVNAARMDGASFFQIFWRIVL 200 + LGL +S+ G++L +A G + R Y IP EL++AARMD AS +QI+WRI+L Sbjct: 206 VSALGLFNSLWGVILP-TVATPTGVFIL-RQYMLTIPDELIDAARMDKASEWQIYWRIIL 263 Query: 201 PLSTPIVMVTLIWQFTNIWNDFLFG-VVFSGTDSKPVTVGLNNLANTSSSVKAYNVDMAA 259 PL+ P + V I+ WNDFL+ +V S + + VGL+ + + ++ +A Sbjct: 264 PLTAPALAVLAIFSVVWRWNDFLWPLIVLSRKELYTLQVGLSIYSGELN--VQWHFILAM 321 Query: 260 AIIAGLPTMVIYVLAGKFFVRGLTAGAVK 288 ++ +P +++++ +F G+ +K Sbjct: 322 TVVTMIPVVLVFIFLQRFITTGIAGTGLK 350 Lambda K H 0.327 0.139 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 350 Length adjustment: 27 Effective length of query: 262 Effective length of database: 323 Effective search space: 84626 Effective search space used: 84626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory