Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (uncharacterized)
to candidate WP_106714048.1 CU102_RS26410 alcohol dehydrogenase AdhP
Query= curated2:Q82MN2 (342 letters) >NCBI__GCF_003010955.1:WP_106714048.1 Length = 341 Score = 136 bits (342), Expect = 9e-37 Identities = 103/289 (35%), Positives = 148/289 (51%), Gaps = 15/289 (5%) Query: 3 ALVKEKAEPGLWLMDVPEPEIGPGDVLIKVLRTGICGTDLHIRSWDGWAQQAVRTPLVLG 62 ALV+E +P L + +VP PE GP +L+++ TG+C TDLH D + AV P + G Sbjct: 8 ALVRELGKP-LTIEEVPIPEPGPDQILVRIAATGVCHTDLHAVRGDWPVKPAV--PFIPG 64 Query: 63 HEFVGEVVETGRDVVDIKAGDRVSGEG-HLVCGKCRNCQAGRRHLCRATVGLGVGRDGAF 121 HE VG VV GR V +K GDRV H CG C +C+ G LC + G +G+F Sbjct: 65 HEGVGTVVGIGRSVKRVKEGDRVGIPWLHTACGYCSHCRTGWETLCGSQKNSGYSVNGSF 124 Query: 122 AEYVALPAANVWVHRVPVDLD--VAAIFDPFGNAVHTALSFPLV--GEDVLITGAGPIGL 177 AE+ A +V R+P LD AA G V+ AL V GE ++I+G G +G Sbjct: 125 AEFAV--ADPNYVGRLPDALDWGPAAPILCAGVTVYKALKETEVKPGEWIVISGIGGLGH 182 Query: 178 MAAAVARHAGARNVMITDVSEERLELARKIGVSLALNVADTTIADG-QRALGLREGFDIG 236 +A AR G +V D+ ++LELA K G + +N ++ + QR +G G Sbjct: 183 VAVQYARAMG-MHVAAVDIYPDKLELAAKFGAEIVINASEVDPGEEVQRRIGGAHG---A 238 Query: 237 LEMSGRPEAMRDMIANMTHGGRIAMLGLPSQEFPVDWARIVTSMITIKG 285 L + P A A + G +A++GLPS +F + V IT++G Sbjct: 239 LVTAVSPTAFEQAFAMLRSHGTMALVGLPSGKFAMPIFDTVLKRITVRG 287 Lambda K H 0.322 0.140 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 341 Length adjustment: 29 Effective length of query: 313 Effective length of database: 312 Effective search space: 97656 Effective search space used: 97656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory