Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_106709908.1 CU102_RS05080 ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_003010955.1:WP_106709908.1 Length = 341 Score = 314 bits (805), Expect = 2e-90 Identities = 179/361 (49%), Positives = 232/361 (64%), Gaps = 34/361 (9%) Query: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 M +L L +EK +G +V+ ++L I+ GE +VFVGPSGCGKSTLLRMI+GLE I+GG L Sbjct: 1 MTNLLLKNIEKRFGKTEVIRGVDLVIEHGEFVVFVGPSGCGKSTLLRMISGLEDISGGEL 60 Query: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 I ++N++ A+RG+AMVFQSYALYPH++VR+NM F LK+ K S+ E V AAA Sbjct: 61 YIGNRLMNEIQAAKRGVAMVFQSYALYPHLSVRDNMGFGLKVRKVSEEERIRRVAAAAAT 120 Query: 121 LQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLK 180 L+L LDR P+ LSGGQRQRVAIGR+IV +P V+LFDEPLSNLDA LRV R EIA L Sbjct: 121 LKLEALLDRFPRELSGGQRQRVAIGRAIVGNPAVFLFDEPLSNLDAELRVHMRSEIAALH 180 Query: 181 EAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKM 240 + + +TM+YVTHDQ+EAMTLA +IVVL G I QVGSP ELYE P N+FVAQFIGSP+M Sbjct: 181 KRL-STTMIYVTHDQIEAMTLADKIVVLRDGRIEQVGSPRELYENPANQFVAQFIGSPRM 239 Query: 241 NLLP---GKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPGGDY 297 N+LP ++ + T V A +VG+RPE + + Sbjct: 240 NILPAANAAMLAPNSTTPV--------------------TAKSVGIRPEH-IAIVSSSES 278 Query: 298 VFEGKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIHKDLK----GQVTRLTAEPAKVHV 353 GKVA+ E G VTL++ + P+ + + +H + G L AEPA +H Sbjct: 279 ALRGKVALCEYTGAVTLMHVQLPNEQTCLV-----VHDKNEVPPPGSELGLIAEPANLHF 333 Query: 354 F 354 F Sbjct: 334 F 334 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 341 Length adjustment: 29 Effective length of query: 344 Effective length of database: 312 Effective search space: 107328 Effective search space used: 107328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory