Align 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 (characterized)
to candidate WP_106713163.1 CU102_RS21640 2-dehydro-3-deoxy-6-phosphogalactonate aldolase
Query= SwissProt::Q6BF16 (205 letters) >NCBI__GCF_003010955.1:WP_106713163.1 Length = 213 Score = 158 bits (400), Expect = 6e-44 Identities = 90/199 (45%), Positives = 114/199 (57%), Gaps = 1/199 (0%) Query: 3 WQT-KLPLIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPQWEQSIPAIVDAYGDKAL 61 W T K LIAILRG+ PDE LA ++ AG D +E+PLNSP QSI +V L Sbjct: 8 WPTLKRDLIAILRGVKPDEVLAIGEELVSAGIDVIEVPLNSPDPFQSIELLVKNLPPHVL 67 Query: 62 IGAGTVLKPEQVDALARMGCQLIVTPNIHSEVIRRAVGYGMTVCPGCATATEAFTALEAG 121 IGAGTVL P V L G +L+++PN+ + V+ A G GM PG T TEA AL+AG Sbjct: 68 IGAGTVLDPADVVRLDAAGGRLMISPNVDANVLAAAAGSGMVSMPGVFTPTEALAALKAG 127 Query: 122 AQALKIFPSSAFGPQYIKALKAVLPSDIAVFAVGGVTPENLAQWIDAGCAGAGLGSDLYR 181 A LK FP+S G IKA+ A+LP + AVGGV + A + G GLGS LY+ Sbjct: 128 ASGLKFFPASVLGADGIKAISAILPKGTVIGAVGGVDESSFAAYAKVGVRTFGLGSSLYK 187 Query: 182 AGQSVERTAQQAAAFVKAY 200 G S ++A V+AY Sbjct: 188 VGASSSFVRERAKVTVEAY 206 Lambda K H 0.319 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 213 Length adjustment: 21 Effective length of query: 184 Effective length of database: 192 Effective search space: 35328 Effective search space used: 35328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory