Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_106714472.1 CU102_RS29110 2-dehydro-3-deoxy-phosphogluconate aldolase
Query= BRENDA::Q0K1X1 (214 letters) >NCBI__GCF_003010955.1:WP_106714472.1 Length = 212 Score = 212 bits (539), Expect = 5e-60 Identities = 110/207 (53%), Positives = 135/207 (65%) Query: 1 MQNQTSPLLQRLADVPVIPVLEFHSVDEALHVSEALVTGGLPLLEITLRTPVALEAIKAV 60 M +T LL L PVIPV+ +V +A+ ++ AL GGLP +EITLRT AL+AI+AV Sbjct: 1 MTQKTDLLLPVLKGQPVIPVILIQNVADAVPLARALAAGGLPAIEITLRTAAALDAIRAV 60 Query: 61 AAALPQACVGAGTVLNVEQLHAVRDAGAQFAVSPGLTPALAEGAQGAGISLLPGVATASE 120 A +P+A VGAGTVLN Q AG++F VSPG TP L E A+ + + LLPG T E Sbjct: 61 ADEVPEAIVGAGTVLNARQYEEASAAGSRFIVSPGATPQLIEAARHSKVPLLPGAITPGE 120 Query: 121 AMAALEAGFTFLKFFPAQAAGGVPMLKSLGGPLPQLRFCPTGGIDAALAPTYLALPNVVC 180 MA E G+T LKFFPA+ AGG LKSL PL FCPTGG+ A A TYL+LPNVVC Sbjct: 121 IMALREEGYTMLKFFPAEQAGGATFLKSLASPLAGTLFCPTGGVSIANAKTYLSLPNVVC 180 Query: 181 VGGSWVVPKDAVASGDWGRIRTLAEQA 207 VGGSW+ P++ V +G W I LA A Sbjct: 181 VGGSWIAPEELVKAGKWDEITKLAADA 207 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 214 Length of database: 212 Length adjustment: 22 Effective length of query: 192 Effective length of database: 190 Effective search space: 36480 Effective search space used: 36480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory