Align GlcU, component of Glucose, mannose, galactose porter (characterized)
to candidate WP_106712781.1 CU102_RS19540 carbohydrate ABC transporter permease
Query= TCDB::Q97UY9 (287 letters) >NCBI__GCF_003010955.1:WP_106712781.1 Length = 287 Score = 115 bits (288), Expect = 1e-30 Identities = 78/260 (30%), Positives = 129/260 (49%), Gaps = 12/260 (4%) Query: 13 LHYLALAIVSVIWLIPVYAMLINGFKSNFEVLSTPVLVPPTKITFEAYVSVLLSLAKP-- 70 L Y LA++ +W P+ +LI KSN + L+ P +P + TF+ Y+ V SL Sbjct: 21 LGYTLLAVLLAVWSGPIVLVLITSIKSNQDFLAGPFSIP-SHPTFQPYIDVWNSLGFSGL 79 Query: 71 LINSLIIVIPTSFISAFLGAMGAYFFYTLSYSFSRASSAISDVLFSLISLATFIPQEATL 130 L NS + S ++ L + A+ + SR +F LI +PQ+ L Sbjct: 80 LANSFLYATAGSALAVILALVPAF-------ALSRMEVPGKTFIFGLILTGLMLPQQTVL 132 Query: 131 LPLTRLIVSMGLLDSYIGIIFALLIFYIPTGALLMSMFISVIPRSLIEAAKMDGTGDLKI 190 +PL + ++ LLD+ IG+I + +P L++ F++ IPR + +AA ++G D ++ Sbjct: 133 IPLYDTLRTLHLLDTKIGLIIVHAAYGMPAQILILRGFMTSIPREIEKAAYVEGATDFRV 192 Query: 191 FMKIVFPLSMPGFISTLIFIIIQAWNNFFIPLVLVTTPGMKLTSIAVLSY-SGAYGTLYN 249 F KI+ PLS+PG + I W F LVL+ + ++ +L S Y ++N Sbjct: 193 FYKIILPLSLPGIVVGFTLNFIAIWKEFVFGLVLLNSEENFPVTVGMLKLNSDRYMAVFN 252 Query: 250 DTFAAGMVASIIPLAIFVFL 269 AAG+V S IP+ + L Sbjct: 253 -LPAAGLVISQIPIIVLFIL 271 Lambda K H 0.330 0.144 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 287 Length adjustment: 26 Effective length of query: 261 Effective length of database: 261 Effective search space: 68121 Effective search space used: 68121 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory