Align TreU, component of Trehalose porter (characterized)
to candidate WP_106712439.1 CU102_RS17785 ABC transporter permease
Query= TCDB::Q97ZC1 (267 letters) >NCBI__GCF_003010955.1:WP_106712439.1 Length = 264 Score = 96.7 bits (239), Expect = 5e-25 Identities = 74/243 (30%), Positives = 120/243 (49%), Gaps = 7/243 (2%) Query: 10 IVVGIYFLFPLYILVLLAFNSPKYTVLAKFPSLLPVSLTLNNLLTALQGTAFIDPFIKSL 69 + V I FLF L ++L+ S + FP P S +L L T + F+ SL Sbjct: 12 VTVTILFLFLLAPVLLVFPISFSGDQILAFP---PSSWSLQWYEALLGNTVMMSAFLTSL 68 Query: 70 ETATLVGIITIALAIPAGYGLSRLPRAIAYSIIILLLVTNMMPAIVIGIPIAVDFLKLHL 129 AT+V ++++ +AIPA Y + RL + + L ++P IV+G+ I + F + L Sbjct: 69 GLATVVTVLSLIIAIPASYAIVRLKVTGSEFLFNLFTAPLLLPTIVLGLAILIIFASMGL 128 Query: 130 FESVVGLALAQTLITLPLATFILQGTFSSIPIDLEHQARVDGANLFNRLFSVLLPLAAPG 189 + GL + +ITLP A +L + ++ + E A GA V LP+ APG Sbjct: 129 LATFTGLVIGHLVITLPYALRVLSVSLGNLNLACEEAAASLGAKPLAVFGKVTLPMMAPG 188 Query: 190 IAAAFLISWMFSWDEFTYAILLI-PYHSTLPVTIYQDV--TRGNLLAGIAFSLI-FTLPV 245 I AA + ++ S+DE + L P +TLPV ++ V L+A ++ LI TL V Sbjct: 189 IVAATALCFLVSFDEVVITLFLTGPRMTTLPVELFHHVESQADPLVASVSVLLILMTLAV 248 Query: 246 IIL 248 +++ Sbjct: 249 VMI 251 Lambda K H 0.330 0.146 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 264 Length adjustment: 25 Effective length of query: 242 Effective length of database: 239 Effective search space: 57838 Effective search space used: 57838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory