Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_106713056.1 CU102_RS21035 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_003010955.1:WP_106713056.1 Length = 355 Score = 326 bits (835), Expect = 6e-94 Identities = 183/354 (51%), Positives = 233/354 (65%), Gaps = 22/354 (6%) Query: 1 MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRI 60 M IK+ + K +G+ L DI+L+I D EFVVFVGPSGCGKSTLLR +AGL+ S G + Sbjct: 1 MGHIKLTNVAKSFGSVDVLHDISLEIADSEFVVFVGPSGCGKSTLLRMIAGLDRPSRGEL 60 Query: 61 EIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARV 120 I G+ V V ADR LAMVFQSYALYPHM+VR+N+ FG++ ERIAEAAR+ Sbjct: 61 TIDGKLVNNVPAADRGLAMVFQSYALYPHMSVRQNLAFGLENTKMPKAEIVERIAEAARM 120 Query: 121 LQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLH 180 L++E YL+R+PGQLSGGQRQRVAIGRAIV+ P FL DEPLSNLDA+LR R EL LH Sbjct: 121 LEIEPYLERRPGQLSGGQRQRVAIGRAIVRRPVAFLLDEPLSNLDAELRGSTRAELAALH 180 Query: 181 KQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMN 240 +L ATMIYVTHDQVEAMT+AD+IVVL GR+EQVG+P++LY+ P +RFVA FIGSP MN Sbjct: 181 ARLSATMIYVTHDQVEAMTLADRIVVLRAGRVEQVGTPLELYNSPANRFVAGFIGSPHMN 240 Query: 241 VFSSDV---------------GLQDISLDASAA----FVGCRPEHIEIVPDGDGHIAATV 281 + ++ +D +AA +G RP+HI I D G I A + Sbjct: 241 FLDGTIESLGPSKAVVALTGGHRVEVPVDGTAAGARVTLGVRPQHISI-GDKQG-IPAEI 298 Query: 282 HVKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQFDEAG 335 + E LG E++L+ + G +++ G + GA + L S LH F+E G Sbjct: 299 KLVEALGSETVLHADV-AGQKVLVVAPGQHDLMAGAGIHLSLSAAPLHIFNEQG 351 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 355 Length adjustment: 29 Effective length of query: 309 Effective length of database: 326 Effective search space: 100734 Effective search space used: 100734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory