Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate WP_106712771.1 CU102_RS19480 sugar ABC transporter permease
Query= reanno::Dino:3607126 (288 letters) >NCBI__GCF_003010955.1:WP_106712771.1 Length = 307 Score = 164 bits (415), Expect = 2e-45 Identities = 100/283 (35%), Positives = 155/283 (54%), Gaps = 9/283 (3%) Query: 5 VPRKTVFAFIGPAVIGLALVGIAPLLYALWTSLHFYNLTKLRRVEFIGLENYWTVLTDEV 64 V R + P V+ L + I P +Y + ++H + EF+G N+ +L+D Sbjct: 23 VERHLRILMLAPTVLILLTLTIFPSVYMFYAAVHKISPNPDLPWEFVGSGNFARLLSDGQ 82 Query: 65 FWQAMGRTFFLLGTALPLQIALGLGIALVLHQ--PGLTLVKTLARLSLVLPMATTYAVVG 122 F A+ T A+ + LGLG+AL+L + LT +KT+ L++PM V Sbjct: 83 FHVALRNTIIFTVLAVTAEFLLGLGLALLLDKYIRRLTFLKTV----LMIPMMLPPIAVA 138 Query: 123 LLGQVMFNQKFGVVNQL---LGGADINWIGDPENAFAMIIFWDVWQWTPFVALVLLAGLT 179 + ++++ +FGV+N++ LG W GD A II DVWQWTPF+ L++LAGL Sbjct: 139 ITWKIIYEPQFGVLNEIMFRLGLPLQAWAGDANLAMFSIIVADVWQWTPFIFLLMLAGLA 198 Query: 180 MVPGEVEEAARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTRGGPG 239 +P E EAA L+ S W + LPFL P + L+LR D L+LFD+VF LT GGP Sbjct: 199 SLPVEPYEAAALDGASSWRQFWDLTLPFLKPVIAIALLLRVMDALRLFDLVFILTGGGPA 258 Query: 240 SSTEFISLMIQRVGFRGFDQGLASAQAIILLIITIVLAQIYIR 282 T+ +SL + +V +R D G A+A ++ +L TI+L+ +++ Sbjct: 259 DRTKVLSLYVYQVAYRFADTGYAAAISLFVLFATIILSTWFMK 301 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 307 Length adjustment: 26 Effective length of query: 262 Effective length of database: 281 Effective search space: 73622 Effective search space used: 73622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory