Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_106709805.1 CU102_RS04540 carbohydrate ABC transporter permease
Query= uniprot:D8IPH9 (270 letters) >NCBI__GCF_003010955.1:WP_106709805.1 Length = 317 Score = 149 bits (376), Expect = 7e-41 Identities = 92/282 (32%), Positives = 134/282 (47%), Gaps = 34/282 (12%) Query: 15 IVLVLVAVFPLLWALLNSVKTLLDIVTPTPRFLFTPTLENY--------RQV------IG 60 I ++ + PL+W +L S K+ D ++ P+ +F PTLE Y RQ +G Sbjct: 26 IAYAVITMIPLVWIVLTSFKSPPDSISYPPKIVFQPTLEGYCNLFTTRTRQTSEYITSLG 85 Query: 61 SPE------------VLVG-------LTNSAVIVGSAVLLGTFMGVPAAYVIARYHVPGK 101 +P V+ G NS VI + L +G AAY +R+ VP Sbjct: 86 APTSTCDEITRSRNMVIAGPSNYWPRFQNSLVIAFGSTFLAVSLGTLAAYGFSRFKVPLA 145 Query: 102 RDIQFFLLSLRFLPPVAVAIPLIAIWVDLGLYDTRFSMIVTYLLTTLSTITWLSIPVFQR 161 D+ FF+LS R +PP+AVAIP+ ++ +LGL DT MI+ Y +S WL Sbjct: 146 EDLLFFILSTRMMPPIAVAIPIYLMYRELGLSDTALGMILLYTAVNVSLAVWLLKGFIDE 205 Query: 162 MPREIEEAATLDGYGPYAVFWKIALPNCATTLLGGIIFSFVLVWNELMIALALTSSNSAT 221 +PRE EEAA +DGY F+K+ LP T + IF + WNE A+ LTS + T Sbjct: 206 IPREYEEAAMIDGYTRMQAFFKVVLPQATTGIAATAIFCLIFAWNEYAFAVLLTSGAAQT 265 Query: 222 LPVVASAFTSMGQEVPWGVINASTVLLALPPLIFVGVLSRLL 263 P G + W + A T + +P L+F +L + L Sbjct: 266 APPFIPTIIGEGGQ-DWPAVAAGTTIFVVPILVFTILLRKQL 306 Lambda K H 0.327 0.142 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 317 Length adjustment: 26 Effective length of query: 244 Effective length of database: 291 Effective search space: 71004 Effective search space used: 71004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory