Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_106712952.1 CU102_RS20485 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_003010955.1:WP_106712952.1 Length = 356 Score = 322 bits (824), Expect = 1e-92 Identities = 177/364 (48%), Positives = 232/364 (63%), Gaps = 10/364 (2%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MA + + K+Y G VL +DL I DGEFVVL+GPSGCGKST+LRMIAGLE+IS G Sbjct: 1 MASVTISNVQKNY-GAMNVLSAVDLSIADGEFVVLVGPSGCGKSTLLRMIAGLEEISAGE 59 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 +RIG VVND+ ++R++AMVFQ+YALYPHM V +N+ F L K I RV A Sbjct: 60 IRIGDRVVNDVAPKDRDIAMVFQSYALYPHMDVAENMGFSLTLRKTAKDLIMNRVGNAAK 119 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 L L+ LER PR +SGGQ+QR A+ RAI++ P VFLFDEPLSNLDAKLR +R +IK L Sbjct: 120 RLGLDVFLERLPRQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSNLDAKLRVHMRTEIKAL 179 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 HQ+L+TT+VYVTHDQ+EAMT+ADR+++M DG I Q G+P ELY +P NLF AGFIG+P M Sbjct: 180 HQQLKTTSVYVTHDQVEAMTMADRIVVMHDGVIQQVGTPLELYDHPANLFVAGFIGSPGM 239 Query: 241 NFLSGTVQRQDGQLFIETAH-QRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREPAAS 299 NFL V RQ ++ E A Q L E R+ V + VRP+++ + G S Sbjct: 240 NFLPAVVSRQGAKVAAELADGQMIPLRPE--LRVEDGDRVTVGVRPENIEVGG------S 291 Query: 300 LTCPVSVELVEILGADALLTTRCGDQTLTALVPADRLPQPGATLTLALDQHELHVFDVES 359 +E++E LG + DQ + PG T++L ++ +HVF ++ Sbjct: 292 DALTAKIEVIEPLGLSTQFYAKLADQQICIFAMGRTDRGPGDTISLGINPTAVHVFHAKT 351 Query: 360 GENL 363 G L Sbjct: 352 GIRL 355 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 356 Length adjustment: 30 Effective length of query: 376 Effective length of database: 326 Effective search space: 122576 Effective search space used: 122576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory