Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_106713066.1 CU102_RS21095 ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_003010955.1:WP_106713066.1 Length = 332 Score = 214 bits (545), Expect = 2e-60 Identities = 118/308 (38%), Positives = 181/308 (58%), Gaps = 4/308 (1%) Query: 19 RLSLDRFGLPLVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGID 78 +L F + + +L C+ ++F+++ F T +N +I R + I+A+GMT VI+T GID Sbjct: 20 KLGSQTFWVLVAVVLACIFLSFATDSFATAKNLYNITRNVTFVAIIALGMTLVIITGGID 79 Query: 79 LSVGSILAFAGLCSAMVATQGYGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGM 138 LSVGS+L + +V GY + ++A + +G +G ++A + +PPFV TLG Sbjct: 80 LSVGSVLCLCSMILGVVMHAGYSIEVGIAASIGTALAVGAFHGLLIAYIGMPPFVVTLGT 139 Query: 139 LSIARGMTFILNDGSPITDLP---DAYLALGIGK-IGPIGVPIIIFAVVALIFWMVLRYT 194 LSIAR + + + + + D L+LG G I P++ V+ALI VLR+T Sbjct: 140 LSIARSLAMVASGNTVVFQFGPDHDKLLSLGGGAWFFGIANPVLYMIVLALITGFVLRWT 199 Query: 195 TYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSY 254 +GR+VYA+GGNE +A +G+ VR + +VY++S L AG+AG++ + + G Sbjct: 200 KFGRHVYAIGGNEHAATLTGVPVRPIKVAVYMISSLSAGIAGIIQTGWLGAITTNIGTGL 259 Query: 255 ELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFA 314 EL IAA VIGG +L+GG G+ G L GA LI VI N L LLG+++++Q G I+ A Sbjct: 260 ELQVIAAAVIGGAALAGGVGTAFGALVGAALIEVIRNSLGLLGINAFWQGCFIGGAILLA 319 Query: 315 VLIDVWRK 322 VL D RK Sbjct: 320 VLFDRLRK 327 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 332 Length adjustment: 28 Effective length of query: 297 Effective length of database: 304 Effective search space: 90288 Effective search space used: 90288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory