Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_106714415.1 CU102_RS28780 ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_003010955.1:WP_106714415.1 Length = 342 Score = 259 bits (662), Expect = 7e-74 Identities = 147/346 (42%), Positives = 215/346 (62%), Gaps = 27/346 (7%) Query: 1 MNAKTITAPVTA---APRNRLRLS------LDRFGLPLVFILLCVVMAFSSEYFMTWRNW 51 M ++ +TA T PR+R RL L G+ L+F +L + A S + M ++ Sbjct: 1 MTSEPVTAKATTPTLTPRSRRRLPPEVNILLVLIGIALIFEILGWIFAGQS-FLMNFQRL 59 Query: 52 MDILRQTSINGILAVGMTYVILTKGIDLSVGSILAFAGLCSAMVATQG------YGLLA- 104 I+ Q S+ GI+AVG+T VI+T GIDLS GS++ + +A A Y L Sbjct: 60 RIIILQVSVIGIIAVGVTQVIITGGIDLSSGSVVGMTAMIAASFAQSSTWARPVYPALTD 119 Query: 105 -----AVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGMLSIARGMTFILNDGSPITDLP 159 + G+ G + G+VNG+++A IPPF+ATLGM+ ARG+ GSP++ L Sbjct: 120 LPFFIPIGVGLGIGLLAGIVNGWLIAYTKIPPFIATLGMMVSARGVAKWYTKGSPVSGLT 179 Query: 160 DAYLALGIGKIGPIGVPIIIFAVVALIFWMVLRYTTYGRYVYAVGGNEKSARTSGIGVRK 219 D + +G P+++F +VALIF + LRYT YG++ YA+G N ++AR SGI + + Sbjct: 180 DQFTFIGASIW-----PVVVFLLVALIFHVALRYTRYGKFTYAIGANLQAARVSGIDIER 234 Query: 220 VMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYELDAIAAVVIGGTSLSGGTGSIVGT 279 + VY ++GLLAGLAG+V +AR +A GV+YELDAIAA VIGGTSL+GG G I GT Sbjct: 235 HLIKVYAIAGLLAGLAGIVTAARAQTAQAGMGVTYELDAIAAAVIGGTSLTGGIGRITGT 294 Query: 280 LFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAVLIDVWRKKKR 325 + GA+++GV+ +G L V +YYQ++ KG+IIV AV++DV+R+KKR Sbjct: 295 VIGAIILGVMISGFTFLRVDAYYQEIIKGVIIVAAVIVDVYRQKKR 340 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 342 Length adjustment: 28 Effective length of query: 297 Effective length of database: 314 Effective search space: 93258 Effective search space used: 93258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory