Align ABC transporter for D-Glucose-6-Phosphate, permease component 2 (characterized)
to candidate WP_106712565.1 CU102_RS18495 sugar ABC transporter permease
Query= reanno::WCS417:GFF4323 (302 letters) >NCBI__GCF_003010955.1:WP_106712565.1 Length = 292 Score = 348 bits (894), Expect = e-101 Identities = 165/285 (57%), Positives = 216/285 (75%) Query: 16 LQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTNSTFLPTYKWAGLAQYARLFDNDRWW 75 +Q +PKLVL PS IVL+ YG+I +T +LSFT+S LP+Y + GL Y +L+ WW Sbjct: 7 IQDLIPKLVLGPSFLIVLIFVYGFIAYTGLLSFTDSKMLPSYGFVGLENYRKLWALPHWW 66 Query: 76 VASKNLAVFGGMFIGITLVIGVTLAIFLDQKIRREGFIRTIYLYPMALSMIVTGTAWKWL 135 A NL +F ++I I VIG+ LAI LDQKIR EGF+R IYLYPMALS IVTG AWKW Sbjct: 67 RAITNLGIFASLYIIICTVIGLGLAILLDQKIRIEGFLRPIYLYPMALSFIVTGVAWKWF 126 Query: 136 LNPGMGLDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVDQS 195 L+PG+GL+ + WGWE F +W+ D + +Y +VIAAVWQ+SGF+MAMFLAGLRGVD Sbjct: 127 LDPGIGLENTMHQWGWESFSFNWIKDRNMAIYTVVIAAVWQSSGFVMAMFLAGLRGVDNE 186 Query: 196 IVRAAQIDGASMPRIYWSVVLPSLRPVFFSAVMILAHIAIKSFDLVAAMTAGGPGYSSDL 255 I++AAQIDGAS IY +++P +RPVF SA ++LAH+AIK++DLV A+T GGPG +++L Sbjct: 187 IIKAAQIDGASTGMIYRRIIIPLMRPVFLSAFVVLAHLAIKAYDLVIALTGGGPGQATEL 246 Query: 256 PAMFMYSFTFSRGQMGMGSASAILMLGAILAIIVPYLYSELRTKR 300 PA FMYS+TF+R MG+G++SAI+ML I +II+PYLYSE+R R Sbjct: 247 PATFMYSYTFTRNSMGIGASSAIIMLIMIFSIIIPYLYSEVRGDR 291 Lambda K H 0.330 0.141 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 292 Length adjustment: 26 Effective length of query: 276 Effective length of database: 266 Effective search space: 73416 Effective search space used: 73416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory