Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate WP_100845790.1 C0J26_RS16150 CoA transferase subunit B
Query= BRENDA::P0A102 (213 letters) >NCBI__GCF_003031005.1:WP_100845790.1 Length = 221 Score = 200 bits (508), Expect = 2e-56 Identities = 102/198 (51%), Positives = 136/198 (68%), Gaps = 2/198 (1%) Query: 7 LSRTEMAQRVAADIQEGAYVNLGIGAPTLVANYLGD-KEVFLHSENGLLGMGPSPAPGEE 65 LSR +MAQRVA ++Q+G YVNLGIG PTLVANY+ + EV L SENGLLGMGP P Sbjct: 3 LSREQMAQRVAREMQDGYYVNLGIGIPTLVANYIPEGMEVMLQSENGLLGMGPFPTEETI 62 Query: 66 DDDLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGAEG 125 D D+INAGKQ VT G + F A+SF+M+RGGH+D+ VLGAF+V V+G++A+W + Sbjct: 63 DADMINAGKQTVTARIGASIFSSAESFAMIRGGHVDLTVLGAFEVDVEGNIASWMIPGK- 121 Query: 126 SIPAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLEVT 185 + +GGAMDL GA + V+M H +K GESKL+ +C+ PLTG C+ R+ TDLA LE+ Sbjct: 122 LVKGMGGAMDLVAGADNIIVIMTHASKDGESKLLSKCSLPLTGAGCIKRVLTDLAYLEIE 181 Query: 186 PEGLKVVEICADIDFDEL 203 + E + +E+ Sbjct: 182 NGAFVLKERAPGVSVEEI 199 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 221 Length adjustment: 22 Effective length of query: 191 Effective length of database: 199 Effective search space: 38009 Effective search space used: 38009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory