Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_100845789.1 C0J26_RS16155 acetyl-CoA C-acetyltransferase
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_003031005.1:WP_100845789.1 Length = 393 Score = 233 bits (595), Expect = 5e-66 Identities = 148/398 (37%), Positives = 220/398 (55%), Gaps = 21/398 (5%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQ 60 M + VIV+ RT IG +++G+L + L I +++ G+D +V++V+MG + Sbjct: 1 MQDVVIVAATRTAIG-SFQGSLASVSAVDLGAAVIRQLLEQTGLDGAQVDEVIMGQVLTA 59 Query: 61 GATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESI 120 GA G N AR+A ++AGLP T+++ C SGL+A+ L A+++ ++ + GG E++ Sbjct: 60 GA-GQNPARQAAIKAGLPHAVPAMTLNKVCGSGLKALHLGAQAIRCGDADVIIAGGQENM 118 Query: 121 SLVQ--------NDKMNTFHAVDPALEAIKGDVY--MAMLDTAETVAKRYGISRERQDEY 170 SL +M VD + D + M TAE + +Y ISRE+QD + Sbjct: 119 SLSNYVMPGARTGLRMGHAQIVDTMISDGLWDAFNDYHMGITAENLVDKYEISREQQDAF 178 Query: 171 SLESQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGL 230 + SQ++ AAA + G+F +EI PI ++ + G + DE PR TTAE L Sbjct: 179 AAASQQKAAAAIEAGRFVEEITPI-----LIPQRKG----DPVAFQVDEQPRGATTAESL 229 Query: 231 AGLKAVRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEM 290 A L+ + ++TAGNAS L+DGA+A ++MS + A A GL L + G +P M Sbjct: 230 AKLRPAFKKDGSVTAGNASSLNDGAAAVILMSAEKAKALGLPVLAKIAAYANAGVDPAIM 289 Query: 291 GIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGH 350 GIGPV A R L + G + + L E NEAFA Q L L D +K+NVNGGAI++GH Sbjct: 290 GIGPVSATRRCLDKAGWDIGQLDLIEANEAFAAQSLAVAKDLQWDLDKVNVNGGAIALGH 349 Query: 351 PYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSA 388 P G SG R+ L E +R AK + T+C+GGG G A Sbjct: 350 PIGASGCRVLVTLLHEMIKRDAKKGLATLCIGGGQGVA 387 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 393 Length adjustment: 31 Effective length of query: 364 Effective length of database: 362 Effective search space: 131768 Effective search space used: 131768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory