Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_095191311.1 C0J26_RS22940 acetyl-CoA C-acetyltransferase
Query= SwissProt::P0C7L2 (401 letters) >NCBI__GCF_003031005.1:WP_095191311.1 Length = 401 Score = 266 bits (681), Expect = 6e-76 Identities = 167/423 (39%), Positives = 233/423 (55%), Gaps = 44/423 (10%) Query: 1 MREAFICDGIRTPIGR--YGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCAN 58 M +A I D +RTP G+ GAL SV+ +L A L L R LD +DDV+LGC Sbjct: 1 MTQALIFDALRTPRGKGKADGALHSVKPVNLVAGLLTALRNRTA-LDTSQVDDVVLGCVT 59 Query: 59 QAGEDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVE 118 G+ ++A+ A +A SV+G INR C SGL+A+ A +++G DL++ GGVE Sbjct: 60 PIGDQGSDIAKTAVQVADWDVSVAGVQINRFCASGLEAVNLGAMKVRSGFEDLVVVGGVE 119 Query: 119 SMSRAPFVMGKAASAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISR 178 SMSR P A A Q + + Q G D +A L SR Sbjct: 120 SMSRVPMGSDGGAWALDPQTNLH---------SHFTPQGVGADL-------IATLEGFSR 163 Query: 179 EDQDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGL 238 +D D++AL SQQ+ A+A++ G + +VPV +++ G++ + HDE +R E+TLE L L Sbjct: 164 QDVDAYALHSQQKAARARADGSFNKSLVPV--QDQNGIIL-LDHDEFIRAESTLEGLGKL 220 Query: 239 KAPF--------------------RANGVITAGNASGVNDGAAALIIASEQMAAAQGLTP 278 K F R N V T GN+SG+ DGAA ++I SE A GL P Sbjct: 221 KPSFEMIGQMGFDATALRVYSHVERINHVHTPGNSSGIVDGAALMLIGSEAKGRALGLQP 280 Query: 279 RARIVAMATAGVEPRLMGLGPVPATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELG 338 RARIVA A +P +M GP PATR+ L +AGL + D+D+ E+NEAFA+ L ++++ Sbjct: 281 RARIVATAVTSTDPTIMLTGPAPATRKALAKAGLRVEDIDLFEVNEAFASVVLKFIKDMA 340 Query: 339 LPDDAPHVNPNGGAIALGHPLGMSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMIL 398 + D VN NGG+IA+GHPLG +G + EL R RY L T+C+G G GIA I+ Sbjct: 341 V--DPDKVNVNGGSIAMGHPLGATGCAILGTLLDELETRRLRYGLATLCVGGGMGIATII 398 Query: 399 ERV 401 ER+ Sbjct: 399 ERL 401 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 401 Length adjustment: 31 Effective length of query: 370 Effective length of database: 370 Effective search space: 136900 Effective search space used: 136900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory