Align Uncharacterized protein YbdD (characterized, see rationale)
to candidate WP_003228401.1 C0J26_RS26665 YbdD/YjiX family protein
Query= uniprot:P0AAS9 (65 letters) >NCBI__GCF_003031005.1:WP_003228401.1 Length = 65 Score = 109 bits (273), Expect = 3e-30 Identities = 46/65 (70%), Positives = 56/65 (86%) Query: 1 MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYEEFFRERQDARYGGKG 60 MF+ L++ GKYLGQAA+LM+GMPDYD YVEHM+ HPD+ M+YE FFRERQ+ARYGGKG Sbjct: 1 MFNDLSRLGKYLGQAARLMVGMPDYDTYVEHMQTKHPDKPVMSYEMFFRERQEARYGGKG 60 Query: 61 GARCC 65 G +CC Sbjct: 61 GPKCC 65 Lambda K H 0.322 0.139 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 53 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 65 Length of database: 65 Length adjustment: 5 Effective length of query: 60 Effective length of database: 60 Effective search space: 3600 Effective search space used: 3600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 36 (19.6 bits) S2: 36 (18.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory