Align hexokinase (EC 2.7.1.1) (characterized)
to candidate WP_084296009.1 C8J29_RS19290 ROK family transcriptional regulator
Query= BRENDA::Q5SLJ4 (302 letters) >NCBI__GCF_003046325.1:WP_084296009.1 Length = 382 Score = 84.0 bits (206), Expect = 5e-21 Identities = 82/269 (30%), Positives = 113/269 (42%), Gaps = 46/269 (17%) Query: 3 VVGLDLGGTKIAAGVFD-GKRLLSKVVVPTPKEG-------GERVAEALAEAAERAEREA 54 V+ +D G T I + +RLL + P PK VA A+AEA E+ E + Sbjct: 80 VIAVDAGSTHIRLRLSTLDRRLLHASLHPLPKSQYSLTPQISSVVAAAVAEALEKTEADW 139 Query: 55 G--------VRGEAIGL-GTPGPLDFRRGVIRFAPNIPGVQDFPIRRILEEATGRPVFLE 105 G + +G G D FAP P V L Sbjct: 140 GPLLAMVIAIPTRVVGPEGDTAATDQEVIFTNFAPP-PQVD---------------CTLV 183 Query: 106 NDANAAALAEHHLGAAQGEESSLYLTVSTGIGGGVVLGGRVLRGERGQGGELGHLTL--- 162 N+ N AA+AE+H GAA+G ++ ++ V IG G++L G++L G G GE+GH+T Sbjct: 184 NNVNCAAVAEYHYGAARGRQTFAFMQVGVKIGLGLMLNGQILPGVNGAAGEIGHITFPFA 243 Query: 163 -----LPGGPACGCGLEGCLEALAAGRALERDATYAFQRPVDTRELFRLFQAGDPKAERL 217 +PG G E + + A + P DT EL GD A R Sbjct: 244 PGLTPVPGEAERYIGTEAFMTRVRADWPESSG-----RPPADTYELLARAGEGDATALRH 298 Query: 218 VLQAARYVGIGLASLVKAFDPGVVVLGGG 246 V A +G +A V DPG+VVLGGG Sbjct: 299 VEGHAAEIGAVIAICVSVIDPGLVVLGGG 327 Lambda K H 0.318 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 382 Length adjustment: 28 Effective length of query: 274 Effective length of database: 354 Effective search space: 96996 Effective search space used: 96996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory