Align cytochrome c component of deoxyribose dehydrogenase (characterized)
to candidate WP_069330536.1 C8J29_RS05500 cytochrome c
Query= reanno::WCS417:GFF2133 (447 letters) >NCBI__GCF_003046325.1:WP_069330536.1 Length = 296 Score = 136 bits (343), Expect = 8e-37 Identities = 95/300 (31%), Positives = 142/300 (47%), Gaps = 22/300 (7%) Query: 15 LPCLVAAGLLAWYVTREPATPFEQEQAGATFEPALVSRGEYVARLSDCVACHSLA----- 69 L ++ AG ++TR P + AG T E +RGE + C +CH+ Sbjct: 9 LAVVLIAGAAGLWLTR-PVKSDPELFAGLTGE---ATRGERIFWAGGCASCHAAPDATGE 64 Query: 70 GKAPFAGGLEMATPLGAIHATNITPDKSTGIGTYSLADFDRAVRHGVAPGGRRLYPAMPY 129 + +GG + T G NI+PD GIG +S+AD D A+RHG +P G YP+ PY Sbjct: 65 ARLVLSGGERLTTDFGTFVVPNISPDPDHGIGGWSVADLDSALRHGTSPEGSHYYPSFPY 124 Query: 130 PSYVKLSDDDIKALYAFFMQGIKPANQPNIPSDIPWPLNMRWPIALWNGVFAPTATYAAK 189 SY D+ L A F+ + P+++ + P D+ +P N R + W + A ++ + Sbjct: 125 TSYAHAEAQDVADLKA-FLDTLPPSDRADEPHDLAFPFNQRVILGGWK-LLAGGPSWIVE 182 Query: 190 PDQDALWNRGAYIVQGPGHCGSCHTPR-GLAFNEKALDEAGAPFLAGALLDGWYAPSLRQ 248 D RG Y+V+G GHCG CHTPR GL +++ AG P G P+ Sbjct: 183 GDLTPEEERGRYLVEGLGHCGECHTPRNGLGLRDESRWLAGGPNPEGRGTIPNITPAKLD 242 Query: 249 DPNTGLGRWSEPQIVQFLKTG-RNAHAVVYGSMTEAFNNSTQFMQDDDLAAIARYLKSLP 307 WS I ++L +G + G M + N+ Q + D+D AIA YLK +P Sbjct: 243 --------WSAGDIAEYLSSGFTPEYDSAGGQMADVVRNTGQ-LPDEDRRAIAAYLKRVP 293 Lambda K H 0.318 0.133 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 296 Length adjustment: 29 Effective length of query: 418 Effective length of database: 267 Effective search space: 111606 Effective search space used: 111606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory