Align alcohol dehydrogenase (quinone) (EC 1.1.5.5) (characterized)
to candidate WP_069333644.1 C8J29_RS05030 glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase
Query= BRENDA::Q44002 (739 letters) >NCBI__GCF_003046325.1:WP_069333644.1 Length = 781 Score = 164 bits (416), Expect = 1e-44 Identities = 169/626 (26%), Positives = 247/626 (39%), Gaps = 118/626 (18%) Query: 53 PGNWMTYGRTYSEQRYSPLDQINRSNVGNLKLAWYLDLD--------TNRGQEGTPLVID 104 PG W YGRT QRYSPL+QIN NV L+ W T + TPL +D Sbjct: 159 PGEWHQYGRTQYGQRYSPLEQINIQNVAELEQVWQYQTGDVKLPQDVTETTYQVTPLKVD 218 Query: 105 GVMYATTNWSMMKAVDAATGKLLWSYDPRVPGNIADKGCCDTVNRGAAYWNG-------- 156 +Y T ++ A+DAATGK W +D G D+ RG YW Sbjct: 219 DRLYICTPHNLAIALDAATGKEAWRFDAN-SGLEPDRQ--HQTCRGVTYWRDPARAEGEL 275 Query: 157 ---KVYFGTFDGRLIALDAKTGKLVWSVNTIPPEAELGKQRSYTVDG------APRIAKG 207 +VY T D RLIALDA++G V + L YT +G P G Sbjct: 276 CAERVYLPTADARLIALDARSGA-VCTFFADEGTLHLESGMPYTPEGFYYSTSPPVAVGG 334 Query: 208 RVIIGNGGSE----FGARGFVTAFDAETGKVDWRFFTAPNPKNEPDHTASDSVLMNKAYQ 263 R+IIG ++ F G + AFDA TG + W + PD TA + + Y Sbjct: 335 RIIIGGAVNDNFSVFSQSGVIRAFDANTGALLWNW-----DSGNPDETAPIDWMNGETYT 389 Query: 264 TWSPTGAWTRQGGGGTVWDSIVYDPVADLVYLGVGNGSPWNYKY-RSEGKGDNLFLGSIV 322 SP W D LVY+ +GN P + RS ++ S+V Sbjct: 390 ANSPNS-----------WSVFSVDEERGLVYIPLGNQVPDQLGFDRSPAVEEHS--SSVV 436 Query: 323 ALKPETGEYVWHFQETPMDQWDFTSVQQIMTLDLPINGETRHVIVHAPKNGFFYIIDAKT 382 AL TG+ W FQ D WD Q + +DL I+G+T +V K G Y+++ +T Sbjct: 437 ALDVTTGQKAWVFQTVHHDLWDMDVPAQPVLIDLDIDGQTVPALVQPTKQGDIYVLNRET 496 Query: 383 GEFISGKNYVYVNWASGLDPKTGRPIYNPDAL----YTLTGKEWYGI------------- 425 GE I GL ++ P AL L K+ +G+ Sbjct: 497 GEPILPVTEEPAPQEGGLPEESPAPTQPTSALSFKPAALREKDMWGVTIYDQLACRIQYH 556 Query: 426 -------------------PGDLGGHNFAAMAFSPKTGLVY------------IPAQQVP 454 PG+ G N+ ++A P+ +++ +PA+ +P Sbjct: 557 RLNYEGRYTPPSLNGTIVYPGNFGTFNWGSVAVDPERQVMFGMPTYLPFTVELVPAEDIP 616 Query: 455 FLYTNQVG---GFTPH---PDSWNLGLDMNKVGIP-DSPEAKQAFVKDLKGWIVAW---- 503 N+ G + P +G + +G+P +P DL+ +A+ Sbjct: 617 PPGANETASEQGLNRNEGAPYGVIMGPFLGPLGVPCSAPPWGYVAGADLRTGDIAYMHRN 676 Query: 504 ----DPQKQAEAWRVDHKGPWNGGILATGGDLLFQGLANGEF-HAYDATNGSDLFHFAAD 558 D +V P GG + T G + F G A ++ AYD T G L+ Sbjct: 677 GTVRDMTPLPLPLKVG--VPGIGGPIVTRGGVAFLGAAVDDYLRAYDVTTGEQLWQARLP 734 Query: 559 SGIIAPPVTYLANGKQYVAVEVGWGG 584 +G + P+TY +G+Q+V + G G Sbjct: 735 AGGQSTPMTYEQDGRQFVVIVAGGHG 760 Lambda K H 0.318 0.137 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 2092 Number of extensions: 173 Number of successful extensions: 12 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 4 Number of HSP's successfully gapped: 2 Length of query: 739 Length of database: 781 Length adjustment: 40 Effective length of query: 699 Effective length of database: 741 Effective search space: 517959 Effective search space used: 517959 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory