Align Fructose import permease protein FruF (characterized)
to candidate WP_108223269.1 C8J29_RS11820 ABC transporter permease
Query= SwissProt::Q8G846 (356 letters) >NCBI__GCF_003046325.1:WP_108223269.1 Length = 363 Score = 136 bits (342), Expect = 1e-36 Identities = 100/315 (31%), Positives = 162/315 (51%), Gaps = 19/315 (6%) Query: 22 TWSIVAFILLVIICTIFQHDFLALSWNSNTGGLAGPLITMLQESARYLMIATGMTLVIST 81 T S+V I+LV+ +IF L + S A L +LQ+ A ++ TLV+ T Sbjct: 42 TPSLVPLIVLVVSVSIFGA-LLGQKFFS-----AFTLTLILQQVAIVGIVGAAQTLVVLT 95 Query: 82 AGIDLSVGSVMAVAGAAAMQ-TLSNGMNVWLSILIALAVGLAIGCVNGALVSFLGLQPFI 140 AGIDLSVG++M ++ Q T G+ LS+L LA G IG VNG LV+ + L PFI Sbjct: 96 AGIDLSVGAIMVLSSVIMGQFTFRYGIPAPLSVLCGLAAGAGIGFVNGTLVARMKLPPFI 155 Query: 141 TTLIMMLAGRGMAKVITSGENTDASAVAGNEP-LKWFANGFILGIPA----------NFV 189 TL M + ++ E + ++ P L++F N F LG V Sbjct: 156 VTLGMWQIVLAANFLYSANETIRSQDISAQAPILQFFGNTFRLGADEAGRGGAVFTYGAV 215 Query: 190 IAVIIVILVGLLCRKTAMGMMIEAVGINQEASRMTGIKPKKILFLVYAISGFLAAIAGLF 249 + +++V+++ + R+TA G + AVG + +A+ + G++ + +L VY +SG + A+AG Sbjct: 216 LLILLVLVIAYVLRQTAWGRHVYAVGDDPDAAELAGVQTRNVLVTVYTLSGLICALAGWV 275 Query: 250 ATASVMRVDVVKTGQDLEMYAILAVVIGGTSLLGGKFSLAGSAVGAVIIAMIRKTIITLG 309 + V GQ + +I AVVIGG SL GG+ S+ G GA+I+ + + +G Sbjct: 276 MIGRLGSVSPT-AGQFANIESITAVVIGGISLFGGRGSVLGMLFGALIVGVFSLGLKLMG 334 Query: 310 VNAEATPAFFAVVVI 324 + + T +++I Sbjct: 335 TDPQWTYLLIGMLII 349 Lambda K H 0.325 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 363 Length adjustment: 29 Effective length of query: 327 Effective length of database: 334 Effective search space: 109218 Effective search space used: 109218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory