Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_069332029.1 C8J29_RS20170 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_003046325.1:WP_069332029.1 Length = 359 Score = 345 bits (884), Expect = 1e-99 Identities = 185/362 (51%), Positives = 244/362 (67%), Gaps = 12/362 (3%) Query: 1 MSALEIRNIRKRYGEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGDI 60 M+ + ++ I KRYG +E + G+D+ +E GEF+ +G SGCGKST+L +IAGL + SGG + Sbjct: 1 MARISLQKIVKRYGGMEAIHGVDLEVEDGEFVAFVGPSGCGKSTMLRMIAGLEDISGGHM 60 Query: 61 LIGERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARL 120 IG+R V + PK RD+AMVFQ YALYP+++V NIGFGL+MR P K V + AR+ Sbjct: 61 RIGDRLVNDIEPKGRDVAMVFQDYALYPHMTVRDNIGFGLKMRGEPAETIRKKVEEAARI 120 Query: 121 LQIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLH 180 LQ+E+LLDR+P QLSGGQRQRVA+GRA+VR P+VFLFDEPLSNLDAKLR+EMRT++KRLH Sbjct: 121 LQLEDLLDRRPGQLSGGQRQRVAMGRAIVRKPKVFLFDEPLSNLDAKLRVEMRTQIKRLH 180 Query: 181 QMLRTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSPPMN 240 +MLRTT +YVTHDQ+EAMTLA R+ V+R G I Q P E+Y+RP+ +VA F+GSP MN Sbjct: 181 RMLRTTTIYVTHDQVEAMTLADRVVVLRKGSIIQHGRPLELYERPSCRFVAEFIGSPQMN 240 Query: 241 ILDAEMTAN--GLKIE---GCEEVLPLPAAFNGAAWAGRRVKVGIRPEALRLAAGSEAQR 295 IL + ++ G IE G + LP G V VG+RPE L A EA Sbjct: 241 ILPGRVASSDRGTVIEVGGGAISLSHLPVP------VGTAVDVGLRPEHLEPCAPEEAD- 293 Query: 296 LTASVEVVELTGPELVTTATVGSQRITACLPPRTAVGMGSAHAFTFDGTALHLFDPESGR 355 A V+V+E G + + +G + IT +P A +G A FD LHLFD +G+ Sbjct: 294 FVAEVDVLEELGSDTLAICLMGEREITVRVPADRARSLGRAQPLRFDRQNLHLFDAANGQ 353 Query: 356 SL 357 + Sbjct: 354 RI 355 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 359 Length adjustment: 29 Effective length of query: 331 Effective length of database: 330 Effective search space: 109230 Effective search space used: 109230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory