Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_069332257.1 C8J29_RS14545 D-glycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_003046325.1:WP_069332257.1 Length = 315 Score = 194 bits (492), Expect = 3e-54 Identities = 115/253 (45%), Positives = 151/253 (59%), Gaps = 4/253 (1%) Query: 62 RLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWV 121 R + L+ VG + DVA T GI + NTP +T++TAD +L+L +ARR E V Sbjct: 67 RARILANFGVGTNHIDVAAATAAGIAVTNTPGAVTDATADIALTLMLMTARRAGEGERLV 126 Query: 122 KAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEE 181 + G W+ + G+ + GK LGI+G+GRIG A+ARRA GF M++ + NRS P A+ Sbjct: 127 RRGAWEGWHPTQMLGLHMTGKRLGILGMGRIGKAIARRAHHGFGMEITFFNRS--PVADP 184 Query: 182 AYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKA 241 + AR+V AE L AD V + VP TP T HL+ AA L M+ AIL+N +RG VDE A Sbjct: 185 SVPARQVGFAEALG-ADIVVVAVPATPATHHLVDAAALGQMRPGAILVNIARGDIVDETA 243 Query: 242 LIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAAENL 301 LI AL G + GAGLDV+E EP + L + NV LPH+G+A E R AM A ENL Sbjct: 244 LIAALAEGRLAGAGLDVYEFEP-EVPAALRAMENVTLLPHLGTAALEVREAMGLMAVENL 302 Query: 302 VAALDGTLTSNIV 314 +A DG N V Sbjct: 303 LAFADGRPLPNAV 315 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 315 Length adjustment: 27 Effective length of query: 294 Effective length of database: 288 Effective search space: 84672 Effective search space used: 84672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory