Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_069332842.1 C8J29_RS18660 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::G3LHY9 (356 letters) >NCBI__GCF_003046325.1:WP_069332842.1 Length = 352 Score = 226 bits (575), Expect = 9e-64 Identities = 127/334 (38%), Positives = 198/334 (59%), Gaps = 15/334 (4%) Query: 21 KDYS----LKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNL 76 K YS ++++ + +DG +GPSGCGK+TLL +I+GL G + + V + Sbjct: 11 KSYSDLTVIEDLSFDIHDGEFMVFVGPSGCGKSTLLRMIAGLESFQGGEVAIGERVVNGV 70 Query: 77 STQSRNIAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRVRDILEMIDLASWARRK 136 + RNIA VFQ +Y MT+ DN++F L+ R A+++RRV E++ + RK Sbjct: 71 PARDRNIAMVFQDYALYPHMTIRDNMSFGLKMRKTPTAEIERRVAAAAEILQIGHLLDRK 130 Query: 137 AQGLTADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVY 196 + L+ Q+Q++++GR +VR + + LFDEPL+ +D ++ +R+++KRLH + G TM+Y Sbjct: 131 PRALSGGQRQRVAMGRAIVR-EPDVFLFDEPLSNLDAKLRVEVRTEIKRLHARLGATMIY 189 Query: 197 VTHDQTEALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYFIGSPGMNFMPARIEG- 255 VTHDQ EA+T A+++VV+ G + QIGTP EL+ P FV FIGSPGMNF PARIEG Sbjct: 190 VTHDQVEAMTMADRIVVLKGGAVEQIGTPQELYREPRTRFVAGFIGSPGMNFAPARIEGD 249 Query: 256 -STVKVGDETLTLEYAPKTSGTAKTELGIRPEFIRLG---REGMPITISKVEDIGRQKIV 311 +T+ GD + T + E+GIRPE ++L G+ + VE +G +V Sbjct: 250 VATLVTGDRVPVRRLSSGTR-AVQGEIGIRPEHVQLADPHGPGVETLVDVVEPLGADTLV 308 Query: 312 RARFADQPIAIVVPEDADIPADA---RVTFDPSA 342 R + + + +P + IPA+ R++F P A Sbjct: 309 AVRLGEAQLMVRLPGEI-IPAEGDRLRLSFTPGA 341 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 352 Length adjustment: 29 Effective length of query: 327 Effective length of database: 323 Effective search space: 105621 Effective search space used: 105621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory