Align GguB aka ATU2346 aka AGR_C_4262, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate WP_069330985.1 C8J29_RS17295 ABC transporter permease
Query= TCDB::O05177 (398 letters) >NCBI__GCF_003046325.1:WP_069330985.1 Length = 412 Score = 171 bits (433), Expect = 4e-47 Identities = 112/372 (30%), Positives = 186/372 (50%), Gaps = 14/372 (3%) Query: 26 EYGMLIALVAIMVFFQFYT--GGILFRPVNLTNLILQNSFIVIMALGMLLVIVAGHIDLS 83 + GML LV ++V ++ + P NL NL+ + + ++LG++ V++ G IDLS Sbjct: 36 DLGMLPVLVGLVVISTVFSTLNPVFLAPNNLVNLLFDAATVGFISLGIVCVLMLGQIDLS 95 Query: 84 VGSIVAFVGAIAAILTVQWGMNPFLAALICLVIGGIIGAAQGYWIAYHRIPSFIVTLAGM 143 VGS+ A+ +L V G A L G ++G G + +PSF+ TLAG+ Sbjct: 96 VGSMSGLASAMIGVLWVNMGWPLPAAIAAALGFGALVGLLYGVLLNRFGMPSFVSTLAGL 155 Query: 144 LVFRGLTLFVLGGKNIGPFPTDFQVISTG---FLPDIGGIEGLNTTSMILTVLITVALFY 200 L GL L++LG P ++ G +PD S +L +L L Y Sbjct: 156 LALLGLQLYILGPTGSINLPYASVLVRFGQIYVMPD--------WLSYLLALLPGAVLVY 207 Query: 201 LAWRRRVVNVKHGIDVEPFGFFIVQNLLISGAILFLGYQLSTYRGLPNVLIVMLVLIALY 260 R + +V+ L+++ A+LF Y L+ RG+P + + + L+ Sbjct: 208 TGLRTMARRRAANLSSPGLSVLLVKALVLTAALLFAAYYLNLGRGIPWMFGLFVALVLAM 267 Query: 261 SFVTRRTTIGRRVYAMGGNEKATKLSGINTERLSFLTFVNMGVLAGLAGMIIATRLNSAT 320 ++ RT GR ++A+GGN +A + SGI+ R++ F+ LA L G++ + RL S++ Sbjct: 268 NYGLTRTQWGRSMFAVGGNAEAARRSGIDVRRVNVSAFMLCSTLAALGGILASARLASSS 327 Query: 321 PKAGVG-FELDVIAACFIGGASASGGVGKITGAVIGAFIMGVMNNGMSIVGLGIDFQQMV 379 +AG G L+ IAA IGG S GG G A++G ++ ++NG++++ L + M+ Sbjct: 328 QQAGTGDVNLNAIAAAVIGGTSLFGGRGSAYSALLGILVIQAISNGLTLLNLSSSLRYMI 387 Query: 380 KGLVLLAAVFFD 391 G VL AV D Sbjct: 388 TGGVLAIAVIVD 399 Lambda K H 0.329 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 412 Length adjustment: 31 Effective length of query: 367 Effective length of database: 381 Effective search space: 139827 Effective search space used: 139827 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory