Align MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized)
to candidate WP_069332736.1 C8J29_RS16565 ABC transporter permease
Query= TCDB::P23200 (336 letters) >NCBI__GCF_003046325.1:WP_069332736.1 Length = 330 Score = 154 bits (389), Expect = 3e-42 Identities = 112/337 (33%), Positives = 178/337 (52%), Gaps = 15/337 (4%) Query: 1 MSALNKKSFLTYLKEGGIYVVLLVLLAIIIFQDPTFLSLLNLSNILTQSSVRIIIALGVA 60 MSA+ +L G + L VL+A+ + +P FLS N++N+L +S+ IIA+G+ Sbjct: 1 MSAVTAPRPRFHLHVLGPLLALFVLIALGAWLNPNFLSYGNVTNVLARSAFIGIIAVGMT 60 Query: 61 GLIVTQGTDLSAGRQVGLAAVVAATLLQSMDNANKVFPEMAT-MPIALV-ILIVCAIGAV 118 +I + G DLS G +AA +A ++ SM N + P M + + LV +L+ G + Sbjct: 61 FVITSGGIDLSVG---SMAAFIAGLMILSM---NALLPHMGEGVSVILVGVLVAAGAGLL 114 Query: 119 IGLINGLIIAYLNVTPFITTLGTMIIVYGINSLYYDFVGASPISGFDSGFSTFAQGFVAL 178 G +NG +IA + + PFI TLGTM GI ++ D G + Sbjct: 115 AGWLNGFLIAKVGIEPFIVTLGTM----GIYRSLVTWLADGGTLSLDFGLRGLYRPVYYG 170 Query: 179 GSFRLSY-ITFYALIAVAFVWVLWNKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYAL 237 G +++ I +A++A+ V+ +T FG+++ AIG N + A+ S V V + YAL Sbjct: 171 GILGIAWPIIVFAIVAILGEIVM-RQTAFGRHVAAIGANEQVARYSAVKVPRVRIATYAL 229 Query: 238 SGVFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFT 297 G+ ++ R+GSA+ + G ++EL+AIAA ++GG GG G V G V GV+I + Sbjct: 230 LGLLVGLATIMYVPRLGSASGSTGVLWELEAIAAVIIGGTVLKGGYGRVWGTVVGVLILS 289 Query: 298 VINYGLTYIG-VNPYWQYIIKGAIIIFAVALDSLKYA 333 +I+ L V+PY I+G I+I AV L K A Sbjct: 290 LIDNILNLASIVSPYLNGTIQGVIVILAVVLQREKKA 326 Lambda K H 0.327 0.143 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 330 Length adjustment: 28 Effective length of query: 308 Effective length of database: 302 Effective search space: 93016 Effective search space used: 93016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory