Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate WP_069331237.1 C8J29_RS14155 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= uniprot:Q6MNM2 (347 letters) >NCBI__GCF_003046325.1:WP_069331237.1 Length = 349 Score = 321 bits (823), Expect = 2e-92 Identities = 178/353 (50%), Positives = 230/353 (65%), Gaps = 18/353 (5%) Query: 1 MAKIQFSNIKKSFGSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTI 60 MA+I +++KS+ +V+ G+DL+IA GEF+V+VGPSGCGKSTLLR +AGLE +G I Sbjct: 1 MAEISLRDVRKSYSGLEVIHGVDLEIADGEFVVIVGPSGCGKSTLLRMVAGLEEITAGEI 60 Query: 61 SIDGKKINDIEPQNRDIAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEISEL 120 +I G+ +N +EP+ RDIAMVFQ+YALYPHMTV ENM +GL++ L+ AEI +RV +++ Sbjct: 61 AIGGRVVNRLEPRERDIAMVFQNYALYPHMTVRENMAYGLRIAKLSKAEIEERVARSAKM 120 Query: 121 LQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKRLH 180 L++ LLDRKP++LSGGQRQRVA+GRAL R L DEPLSNLDA LR QMRL+IK L Sbjct: 121 LELGQLLDRKPRQLSGGQRQRVAMGRALVRNPAAFLLDEPLSNLDAKLRVQMRLQIKELQ 180 Query: 181 HNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIGSPEMN 240 ++T IYVTHDQ+EA TL DR+ V+ GV EQI TP+EIY RP TF+A FIGSP MN Sbjct: 181 RTVRTTSIYVTHDQVEAMTLADRLVVMNAGVAEQIATPAEIYDRPATTFVAGFIGSPAMN 240 Query: 241 FLE----GAVLE------KIPWPEARKADQILGIRPDAFALNQGPLGTQEVALGDFQIDI 290 L G LE +P P R D ILGIRP+ + P G +E + + Sbjct: 241 MLPARGLGDALEVAGQRLAVPAPAGR--DLILGIRPE----HLHPAGPEEPGF-ELHVQA 293 Query: 291 SENLGGQQMLHGTLA-GNNVRILVDSMDNFSMKQTLPLKIDLTKAHLFDKKTG 342 E LG HG+LA G ++ + + L + D HLFD TG Sbjct: 294 VEWLGADAFAHGSLADGTDLVLRTPGKAPVRERDRLKVAPDAAALHLFDAGTG 346 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 349 Length adjustment: 29 Effective length of query: 318 Effective length of database: 320 Effective search space: 101760 Effective search space used: 101760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory