Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_069330500.1 C8J29_RS17225 ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >NCBI__GCF_003046325.1:WP_069330500.1 Length = 334 Score = 208 bits (529), Expect = 2e-58 Identities = 112/293 (38%), Positives = 179/293 (61%), Gaps = 1/293 (0%) Query: 39 VVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTFVILTAGIDLSVGS 98 V+ LF+ L + G T+ F ++ N +N++RQ A L++A MT VI TAGIDLSVGS Sbjct: 23 VLSIALFFVLCMLFFGAMTTTFLTSGNLLNVVRQAAPILIVAVAMTLVITTAGIDLSVGS 82 Query: 99 VLA-VSAVLGMQVSLGAAPGWAIPMFIFSGLVMGMVNGAMVALLNINAFVVTLGTMTAFR 157 ++A ++A+ + ++ G +P+ + +G ++G + G +A I AF+VTL ++ R Sbjct: 83 MVALINALAAIVMASGLDWTLTLPLMLVAGALIGGIQGWFIAYQGIPAFIVTLAGLSILR 142 Query: 158 GAAYLLADGTTVLNNDIPSFEWIGNGDFLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYA 217 G A L +G ++ D F W+G G+ L P +A+ V +L +V++ +T G + A Sbjct: 143 GFALYLTEGYSIPIRDAAGFFWLGRGEVLGFPVPALIAILVAVLGFVVMLRTQYGRQVIA 202 Query: 218 IGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAV 277 +G N++AAR G+ VL VY +SG+ S +AG + A+RL + N G+EL IAAV Sbjct: 203 VGSNMEAARRVGMPAKRVLASVYVVSGVASAVAGMLIAARLGSGSSNAAQGFELQVIAAV 262 Query: 278 VLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGLSSFWQYVAKGAVIVLAV 330 VLGGTSLMGG S+ GTV+G + I V+ NGL ++ +S F+ + G +I++A+ Sbjct: 263 VLGGTSLMGGKASMLGTVLGTMTIAVIGNGLILMHISPFFTQIVTGTIILVAI 315 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 334 Length adjustment: 28 Effective length of query: 316 Effective length of database: 306 Effective search space: 96696 Effective search space used: 96696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory