Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_069332736.1 C8J29_RS16565 ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >NCBI__GCF_003046325.1:WP_069332736.1 Length = 330 Score = 185 bits (469), Expect = 2e-51 Identities = 125/328 (38%), Positives = 186/328 (56%), Gaps = 24/328 (7%) Query: 29 LHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAINLVLAAGMTFVIL 88 LH LG P+L + L+ G L NF S N N+L + A ++A GMTFVI Sbjct: 13 LHVLG--PLLALFVLIALGAWL------NPNFLSYGNVTNVLARSAFIGIIAVGMTFVIT 64 Query: 89 TAGIDLSVGSVLAVSAVLGMQVSLGAA---PGWAIPMFIF-------SGLVMGMVNGAMV 138 + GIDLSVGS+ A A L M +S+ A G + + + +GL+ G +NG ++ Sbjct: 65 SGGIDLSVGSMAAFIAGL-MILSMNALLPHMGEGVSVILVGVLVAAGAGLLAGWLNGFLI 123 Query: 139 ALLNINAFVVTLGTMTAFRGAAYLLADGTTV-LNNDIPS-FEWIGNGDFLHVPWLIWVAV 196 A + I F+VTLGTM +R LADG T+ L+ + + + G L + W I V Sbjct: 124 AKVGIEPFIVTLGTMGIYRSLVTWLADGGTLSLDFGLRGLYRPVYYGGILGIAWPIIVFA 183 Query: 197 AVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGLFSGLAGAMSAS 256 V +L +++R+T G H+ AIG N Q AR + ++V V + Y++ GL GLA M Sbjct: 184 IVAILGEIVMRQTAFGRHVAAIGANEQVARYSAVKVPRVRIATYALLGLLVGLATIMYVP 243 Query: 257 RLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMNNGLTILGL-SS 315 RL A+G+ G +EL+AIAAV++GGT L GG G +WGTVVG LI+ +++N L + + S Sbjct: 244 RLGSASGSTGVLWELEAIAAVIIGGTVLKGGYGRVWGTVVGVLILSLIDNILNLASIVSP 303 Query: 316 FWQYVAKGAVIVLAVILDKWRQKDAAQS 343 + +G +++LAV+L R+K AA + Sbjct: 304 YLNGTIQGVIVILAVVLQ--REKKAADA 329 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 330 Length adjustment: 28 Effective length of query: 316 Effective length of database: 302 Effective search space: 95432 Effective search space used: 95432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory